KEGG   Bacillus gibsonii: BGM20_19985Help
Entry
BGM20_19985       CDS       T04820                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bgi  Bacillus gibsonii
Pathway
bgi00730  Thiamine metabolism
bgi00790  Folate biosynthesis
bgi01100  Metabolic pathways
bgi02020  Two-component system
Module
bgi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BGM20_19985
   00790 Folate biosynthesis
    BGM20_19985
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BGM20_19985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgi04147]
    BGM20_19985
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bgi00537]
    BGM20_19985
Enzymes [BR:bgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BGM20_19985
Exosome [BR:bgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BGM20_19985
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bgi00537]
 Enzymes
  BGM20_19985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme ATP-synt_E
Motif
Other DBs
NCBI-ProteinID: AOL32717
Position
complement(3869821..3871197)
Genome map
AA seq 458 aa AA seqDB search
MSLFQNMKSKFLPIAAVSVLTAGIFAGAELQQTEKASAKKQDKAEIRNVIVMIGDGMGTP
YIRAYRSMKNNGDTPNNPKLTEFDRNLTGMMMTHPDDPDYNITDSAAAGTALATGVKTYN
NAIGVDKNGKKVKSVLEEAKQQGKSTGLVATSEINHATPAAYGAHNESRKNMDQIANSYM
DDKIKGKHKIDVLLGGGKSYFNRKDRNLTKEFKQAGYSYVTTKQALKKNKDQQVLGLFAD
GGLAKALDRDSKTPSLKEMTVSAIDRLNQNKKGFFLMVEGSQIDWAAHDNDTVGAMSEVK
DFEQAYKAAIEFAKKDKHTLVIATADHTTGGFTIGANGEKNWHAEPILSAKKTPEFMAKK
ISEGKPVKDVLARYANLKFTSEEIKSVEAAAQADKSKGAYKAIIKIFNTRSNSGWTSTDH
TGEEVPVYAYGPGKEKFRGLINNTDQANIIFKILKTGK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgtttcaaaatatgaaatcaaaatttctgccaatcgccgctgtttctgtcctt
acagctggaatctttgccggagctgagctgcagcaaacagaaaaggccagcgccaaaaaa
caagacaaagctgagatcagaaatgtcattgtgatgataggcgacggcatggggacgcct
tacataagagcctaccgttccatgaaaaataacggtgacacaccgaataacccgaagtta
acagaatttgaccggaacctgacaggcatgatgatgacgcatccggatgaccctgactat
aatattacagattcagcagcagccggaacagcattagcgacaggcgttaagacatataac
aatgcaattggcgtcgataaaaacgggaaaaaagtgaaatcagtacttgaagaggccaaa
cagcaaggcaagtcaacagggcttgtcgccacgtctgaaattaaccacgccactccagcc
gcatatggcgcccacaatgaatcacggaaaaacatggaccaaatcgccaacagctatatg
gatgacaaaataaaaggcaaacataaaatagacgtgctgctcggcggcggaaaatcttat
tttaaccgcaaggacagaaacttgacaaaggaattcaaacaagccggctacagctatgta
acaacgaaacaagcattgaagaaaaataaagatcagcaggtgctcgggcttttcgcagat
ggagggcttgctaaggcgctcgaccgtgacagcaaaacaccgtctctcaaagaaatgact
gtttcagcaattgatcgcctgaaccaaaataaaaaaggatttttcttgatggtcgaaggg
agccagattgactgggcggcccatgacaatgatacagtaggagctatgagcgaggttaaa
gattttgaacaggcctataaagccgcgattgaatttgcgaaaaaagacaaacatacactt
gtgattgcaactgctgaccatacaaccggcggctttaccattggcgcaaacggggaaaag
aattggcacgcagaaccgattctctccgctaagaaaacacctgaattcatggccaaaaaa
atcagtgaaggcaagccggttaaagatgtgctcgcccgctatgccaatctgaaattcaca
tctgaagaaatcaaaagcgttgaagcagctgcacaggctgacaaaagcaaaggggcctac
aaagccatcatcaagatttttaatactcgctccaacagcggatggacgagtaccgatcat
accggcgaagaagtaccggtatacgcgtacggccccggaaaagaaaaattccgcggattg
attaacaatacggaccaggcaaacatcatatttaagattttaaaaactggaaaataa

DBGET integrated database retrieval system