KEGG   Bacillus gibsonii: BGM20_20450Help
Entry
BGM20_20450       CDS       T04820                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bgi  Bacillus gibsonii
Pathway
bgi00071  Fatty acid degradation
bgi00072  Synthesis and degradation of ketone bodies
bgi00280  Valine, leucine and isoleucine degradation
bgi00310  Lysine degradation
bgi00362  Benzoate degradation
bgi00380  Tryptophan metabolism
bgi00620  Pyruvate metabolism
bgi00630  Glyoxylate and dicarboxylate metabolism
bgi00640  Propanoate metabolism
bgi00650  Butanoate metabolism
bgi00900  Terpenoid backbone biosynthesis
bgi01100  Metabolic pathways
bgi01110  Biosynthesis of secondary metabolites
bgi01120  Microbial metabolism in diverse environments
bgi01130  Biosynthesis of antibiotics
bgi01200  Carbon metabolism
bgi01212  Fatty acid metabolism
bgi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BGM20_20450
   00630 Glyoxylate and dicarboxylate metabolism
    BGM20_20450
   00640 Propanoate metabolism
    BGM20_20450
   00650 Butanoate metabolism
    BGM20_20450
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BGM20_20450
   00072 Synthesis and degradation of ketone bodies
    BGM20_20450
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BGM20_20450
   00310 Lysine degradation
    BGM20_20450
   00380 Tryptophan metabolism
    BGM20_20450
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BGM20_20450
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BGM20_20450
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BGM20_20450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgi04147]
    BGM20_20450
Enzymes [BR:bgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BGM20_20450
Exosome [BR:bgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BGM20_20450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOL32807
Position
complement(3962118..3963212)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVDAKRTIFGNQNGLLKPFLPEDLSAPIIRCLSRKLEDQVDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSQSPFSER
ARFSPDAIGDPDMGIAAEYTAARYSISRSMQDEYALLSHQRSRNAHDGGFYREEIVPLGE
LETDEAFLKTRPIEAIIPRAKPVFDTSSGTVTAANSSGIADGAAALLVMEEEKAAALGLK
PVLRFIGSAVSGIHPNYPPAAPVDAIRNLLHTHDVTPEDIGLFEINEAFAVKICVCSQEL
GIPFSKINVRGGALALGHPYGASGAALVTRLFYEAKRRTDCQYVVAAIGSGGGIGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggttattgttgatgcaaaacgaacgatctttggaaatcaaaacggactgctg
aagcccttcctgccggaggatttgtcagctcccatcatccgctgtctcagccgaaagcta
gaggatcaagttgacgaggtcattctcggaaacgctaccggcagaggcggcaacctcgcc
agactgtcagcccttcaagccggactgcctttatcagttcccggaatgacaattgacaga
cagtgcggctccggccttgaagctgtgcgctatgcctgcagccttattcaagcgggagcc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcccctttttcagaacgg
gcccgcttttctccagatgccatcggcgatccagacatgggcattgcggcagaatatacg
gctgcacgctattccatcagcagaagcatgcaggatgagtacgcccttctcagccatcaa
cgcagcaggaacgcgcatgatggaggattttaccgtgaagaaattgttcctctcggggaa
ttggagacggacgaagcatttttgaaaacgcggccaatagaagcgattattccccgtgca
aagccggttttcgacaccagctccggaacagtcacagcagccaacagcagcggcatagca
gacggagcagcggctcttttggtaatggaagaagaaaaagcggcagccctgggacttaag
cctgtgctccggtttatcggcagcgcagtcagtgggattcaccccaactatccgcccgcg
gcaccggttgatgcgatccgtaacctcttacatacacacgatgtaacacctgaggatatc
ggtttatttgaaatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcattcccttttcaaaaatcaatgtgcgcggcggcgccttagctcttggccatccgtac
ggtgcatcaggtgcagctctggtaaccagattgttttatgaagcgaaaagacggacagac
tgtcaatatgtggttgcagccatcggaagcggcggcggaattggacttgctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system