KEGG   Brenneria goodwinii: AWC36_00335Help
Entry
AWC36_00335       CDS       T05061                                 

Definition
(GenBank) exoribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
bgj  Brenneria goodwinii
Pathway
bgj03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bgj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AWC36_00335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bgj03019]
    AWC36_00335
   03016 Transfer RNA biogenesis [BR:bgj03016]
    AWC36_00335
Enzymes [BR:bgj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     AWC36_00335
Messenger RNA biogenesis [BR:bgj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     AWC36_00335
Transfer RNA biogenesis [BR:bgj03016]
 Prokaryotic Type
  tRNA degradation factors
   AWC36_00335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB CSD2 HTH_12 S1 RNA_pol_Rbc25 OB_Dis3
Motif
Other DBs
NCBI-ProteinID: ATA22682
UniProt: A0A0G4JW33
Position
71616..74072
Genome map
AA seq 818 aa AA seqDB search
MSQDPFLEREAEKYESPIPSREYILAHIAKRDTPIKREELAADLQLTSEEQLEALRRRLR
AMERDGQLIFTRRQCYALPEKLDLLRGTVIGHRDGYGFLRVEGRKDDLYLSAEEMKRAIH
GDVVLAQPLGADRKGRREGRIVRVLEPRTGQIVGRYFVDAGVGFVVPDDSRLSFDILIPK
EEINGARMGAVVVVELAQRATRRTKAVGKIVEVLGDTMGTSLAVDIALRTHDIPHTWPPK
VEEQVKDLAEEVPEEAKKGRIDLRKLPLVTIDGEDARDFDDAVYCEKKRGGGWRLWVAIA
DVSYYVRPNTPLDHEARARGTSVYFPSQVVPMLPEVLSNGLCSLNPQVDRLCMVCEMTVS
AQGKLSSYKFYEGLMSSHARLTYTKVWSILQGDAELRERYKPLVGGLEELHRMYKVLDKA
REIRGGIAFETEEAKFIFNADRRIERVESVVRNDAHKLIEECMILANISAAKFVEKNEEP
ALFRVHDRPSEDHVLALRSVLGELGLTLKGGMKPQPKDYAALMVEVADRPDSEMLQTMLL
RSMKQAVYDPENRGHFGLSLASYGHFTSPIRRYPDLSLHRSIKYLLSSRKERWTPTGGWH
SDMNEMLQLGMHCSMTERRADEATRDVADWLKCDFMQDHVGEVFTGIIASVTGFGFFVRL
NDLFIDGLVHVSTLDNDYYRYDNIGQRLIGESRGQVYRLGDEVEIRVEAVHMDERNIDFA
LVSSTRKPRGEGKTARDRAKKTDNREAKPARRRRNTAKPAANFEPDSAFRKEGERKAKPA
ASKSKPKKNADKAKKNAEKTRKIAAVTKAKRAKKKPAE
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagacccatttctggaacgagaagcagaaaaatacgaatccccaattcctagt
cgtgaatatattctggcccatattgccaaacgagatactccgattaagcgagaagagctg
gcggccgatctacagttaaccagcgaagagcaactcgaggcgctgcgtcgtcgtctgcgg
gcgatggaacgcgacggtcagttgattttcacccgtcgtcaatgctatgccctgccggaa
aaactggatttgctgcgcggtacggtgatcggccaccgcgacggctatggctttctgcgc
gtggaaggccgcaaagatgacctttatctgtccgcggaagagatgaaacgcgccattcat
ggcgatgtggtgctggctcagccgctgggcgccgaccgcaaaggacggcgagaaggccgt
atcgtccgcgtgctggaaccgcgtaccgggcagattgtcgggcgctattttgttgatgcc
ggcgtcggttttgtcgtcccggacgatagccgtctcagtttcgatattctcatcccgaaa
gaagagatcaacggcgcgcggatgggcgcggtggtggtggtggagctggctcagcgcgcc
acgcgccgcacgaaagcggtagggaaaatcgtcgaggtgctgggcgataccatggggacc
agcctggcggtggatatcgccctgcgtacccacgacatcccgcatacctggccgccgaag
gtggaagaacaggtcaaggatttggcggaagaggtgccggaagaagcgaaaaaaggccgc
attgatttacgcaaactgccgctggtgaccatcgacggcgaagacgcccgtgatttcgac
gatgcggtgtactgcgagaaaaaacgcggcggcggctggcgtctgtgggtggcgattgcg
gacgtcagctattatgtacgtccgaatacgccgctggatcacgaggcgcgcgcgcgcggt
acgtcggtttatttcccgtcgcaggtggtgccgatgctgccggaagtgctgtctaacggg
ctgtgttcgcttaacccgcaggttgaccgcctgtgtatggtctgcgagatgaccgtttcg
gcgcaggggaaactctcctcgtataaattctatgaagggctgatgagttcccatgcccgt
ctgacctataccaaagtgtggagcattcttcagggcgacgccgaactgcgcgagcgctat
aaaccgctggtgggcgggctggaagagctgcatcggatgtataaagtattggataaggcg
cgcgagatccgcggcggcatcgccttcgaaacggaagaagccaaatttattttcaatgcc
gatcgccgcatcgagcgggttgagtccgtggtgcgcaacgatgcgcataagctgattgaa
gagtgcatgatcctggcaaatatctccgccgcaaaattcgtggagaaaaatgaggagccg
gcgttattccgcgttcacgatcggccaagtgaagatcatgttctggccttgcgcagcgtg
ctgggcgaactggggctgacgttaaaaggcggcatgaaaccgcagcctaaggactatgcc
gcgttaatggtggaagtcgccgatcgtcccgacagtgaaatgctgcaaactatgctgctg
cgttcgatgaaacaggcggtctacgatccggaaaaccgcggtcactttgggctgtcgctc
gcttcctacggccactttacctcgcctatccgccgctatcccgatttatccctacaccgc
tcgatcaagtatctgctgagctcccgtaaagagcgctggacgccgaccggcggctggcac
agcgatatgaacgagatgctgcaattgggcatgcactgttcgatgacggaacgccgggcc
gatgaagccactcgcgatgtggccgactggctgaaatgcgactttatgcaggatcacgtc
ggcgaagtgttcaccgggattatcgccagcgtgaccggctttggtttctttgtgcgcctc
aacgatctgtttatcgacggactggtgcacgtctccacgctggataatgactactatcgc
tacgataatatcggtcagcgcctgatcggcgagtcgcgcggtcaggtttatcgtctgggc
gatgaagtggaaatccgcgtcgaagccgtgcatatggacgagcgcaatatcgatttcgcg
ctggtttccagcacgcgcaaaccgcgcggcgaaggcaagacggctcgcgatcgggcgaag
aaaacggataaccgcgaggccaaaccggctcgccgccgccgtaacaccgctaaaccggcc
gctaatttcgaaccggattcagccttccgtaaagagggcgagcgtaaagccaaaccggcc
gccagcaaatcgaaaccgaaaaagaacgcggataaagccaaaaagaacgccgagaaaacg
cgtaagatcgccgcagtcaccaaggccaaacgcgcgaagaagaagcctgccgagtga

DBGET integrated database retrieval system