KEGG   Brenneria goodwinii: AWC36_03070Help
Entry
AWC36_03070       CDS       T05061                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bgj  Brenneria goodwinii
Pathway
bgj00130  Ubiquinone and other terpenoid-quinone biosynthesis
bgj00627  Aminobenzoate degradation
bgj01100  Metabolic pathways
bgj01110  Biosynthesis of secondary metabolites
bgj01120  Microbial metabolism in diverse environments
bgj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    AWC36_03070
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AWC36_03070
Enzymes [BR:bgj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     AWC36_03070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein Dak2 CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: ATA23164
UniProt: A0A0G4JXT8
Position
693938..694507
Genome map
AA seq 189 aa AA seqDB search
MKRLIIGISGASGVIYGVRLLQVLQAVDGIEAHLIMSQAARQTLSLETDFSLRDVQALAD
VVHDTRDIAASISSGSFKTAGMVILPCSIKTLSAIAHSYSDNLLARAADVVLKERRRLVL
CVRETPLHLGHLRIMTAAAELGAIIMPPVPAFYHRPQSVQDIVDQTVNRVLDQFDITLSE
DLFTRWQGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgacttattataggtatttccggcgccagcggggtgatttatggcgttcgcctg
ctgcaggttctacaggcggttgacggtatagaagcgcacttgattatgagtcaggcggcc
cggcagacgctgtctttggaaacggatttcagcctgcgcgatgtccaggcgctggccgat
gtggtgcatgatacgcgtgatattgccgccagtatctcttccggttcatttaaaaccgcc
ggcatggtgattctgccctgctcaataaaaaccctgtcggcgattgcccacagctacagc
gacaacctgctggcgcgcgccgccgatgtcgtgctgaaagagcgcaggcgactggtgctc
tgtgtgcgtgaaacgccgctgcatctggggcatctgcgaataatgaccgcggctgcggag
ctaggcgcgattatcatgccgccagtgcccgctttttatcatcgcccgcaaagtgtgcag
gatatcgtcgatcagacggtgaaccgggttctcgatcagtttgatattacgctgtcggaa
gatcttttcactcgctggcaaggcgcgtga

DBGET integrated database retrieval system