KEGG   Brenneria goodwinii: AWC36_03085Help
Entry
AWC36_03085       CDS       T05061                                 

Definition
(GenBank) amino acid ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
bgj  Brenneria goodwinii
Pathway
bgj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bgj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AWC36_03085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgj02000]
    AWC36_03085
Transporters [BR:bgj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    AWC36_03085
   Histidine transporter
    AWC36_03085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ATA23167
UniProt: A0A0G4JYC8
Position
695892..696581
Genome map
AA seq 229 aa AA seqDB search
MFYGYSQLILDGAAMTLKLAVSSLLLALVIGLIGASAKLSPNRLLSGCFSCYTTLIRGVP
DLVLMLLIFYGLQITLNSVTEMLNFRQIDIDPLTAGVITLGFIYGAYFTETFRGAYLAVS
RGQIEAAVAFGFSPMKVFRRILFPSMMRFALPGIGNNWQVILKATALVSLLGLNDVIKAT
QLAGKGAHEPFYFALVAGGMYLIFTTLSNGVLWWLEKHYSQGVRKVSYE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgttctacggctattcccaattaattctcgatggtgcggcaatgacgctgaagctggcg
gtgagttcactgttgctggcgctagtcattggtctgattggggctagcgcgaagctctcc
cccaatcgcctgttatccggctgtttctcctgctataccacgctgattcgcggcgttcct
gatttggtgctgatgctgctgattttttatggtttgcagataacgctgaatagcgtaacg
gagatgctgaatttcagacagattgatatcgatccgcttacggcaggcgtgattactctg
ggttttatctatggcgcctattttaccgaaacgtttcgcggcgcctatctggccgtgtcg
cgcggtcaaattgaggcggccgtcgcatttggtttttcgccaatgaaagtcttccgccgg
atcctgtttccctcaatgatgcgctttgccttacccggcattggcaataactggcaggtg
attttaaaagcgacggctctggtgtcgttacttggcctgaatgatgtgattaaggcaacg
cagcttgccggtaaaggcgcgcatgagccattttatttcgcgctggtcgccgggggcatg
tatttgatttttaccaccctctccaatggggttctgtggtggctggaaaaacactattcg
cagggagtcagaaaggtaagttatgagtga

DBGET integrated database retrieval system