KEGG   Brenneria goodwinii: AWC36_03095Help
Entry
AWC36_03095       CDS       T05061                                 

Definition
(GenBank) amino acid transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bgj  Brenneria goodwinii
Pathway
bgj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bgj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AWC36_03095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgj02000]
    AWC36_03095
Enzymes [BR:bgj01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     AWC36_03095
Transporters [BR:bgj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    AWC36_03095
   Histidine transporter
    AWC36_03095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N ABC_ATPase AAA_13 AAA_29 AAA_15 AAA_16 ATPase_2 AAA_33 AAA_23 RsgA_GTPase AAA_22 Mg_chelatase PRK G-alpha cobW AAA_24 NB-ARC NACHT
Motif
Other DBs
NCBI-ProteinID: ATA23169
UniProt: A0A0G4JXR0
Position
697306..698079
Genome map
AA seq 257 aa AA seqDB search
MSNNKLMVTELRKRYGQLEVLKGISLQAKAGDVISIIGSSGSGKSTLLRCINFLEKPCEG
AIYVNDQEIRMVRDNDGQLKVFDKKQLQMLRTRLTMVFQHFNLWSFMTALENVMEAPVQV
LGLSKAEARERAIFYLNKVGITGDAQDKYPANLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMEFARHVSSHVIFLHQGVIEEEGPPSALF
GSPKSPRLQQFLSGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaataataagctgatggtgacagaactgcgtaagcgttatggacagcttgaggta
ttgaaaggcatttcgttgcaggcgaaagccggggatgtgatttcgattatcggttcatcc
ggttcaggcaagagcacgttgctgcgctgtattaatttcctggaaaagccctgtgagggg
gcgatttatgtcaacgatcaggaaatccgcatggtgcgcgataatgacggccagttgaag
gtttttgataaaaagcagcttcaaatgttgcgcacccggctgacgatggtatttcagcat
ttcaatctgtggagcttcatgaccgcgctggaaaacgtgatggaagcgccggttcaggtg
ttggggctgagtaaggcggaggcgcgtgagcgggcgattttttatctgaataaagtcggc
atcacgggtgacgcgcaggataaatatccggctaacctttcaggcggacagcagcagcgt
gtgtcgattgcccgcgccctggccatggagccggaagtgctgctgtttgatgaacccacg
tccgcgctggatcctgaattggtgggcgaggtgctgcggatcatgcagcaactggctgaa
gaggggaaaacgatggtggtggtgacgcatgaaatggaatttgcgcgccatgtttccagc
catgtgatctttcttcatcagggcgtaattgaagaagaaggaccgccgagcgcgctgttc
ggtagccctaagagcccccgcttacagcagtttctttcgggttccctgaagtga

DBGET integrated database retrieval system