KEGG   Brenneria goodwinii: AWC36_03160Help
Entry
AWC36_03160       CDS       T05061                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bgj  Brenneria goodwinii
Pathway
bgj00430  Taurine and hypotaurine metabolism
bgj00620  Pyruvate metabolism
bgj00640  Propanoate metabolism
bgj00680  Methane metabolism
bgj01100  Metabolic pathways
bgj01120  Microbial metabolism in diverse environments
bgj01200  Carbon metabolism
Module
bgj_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bgj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWC36_03160
   00640 Propanoate metabolism
    AWC36_03160
  09102 Energy metabolism
   00680 Methane metabolism
    AWC36_03160
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AWC36_03160
Enzymes [BR:bgj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AWC36_03160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ATA23182
UniProt: A0A0G4JYE2
Position
complement(711056..712258)
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDAINGEEYLSGLAECFHLPEARIKWKMDGGKQEAALGAG
AAHSEALNFIVNTILSQKPELSEQLVAIGHRIVHGGEKFTQSAIINDSVLQGIKEAIPFA
PLHNPAHLIGIAEALKSFPKLTDKNVAVFDTAFHQTMPEESYLYALPYKLYKDHHIRRYG
AHGTSHYFVTQRAAEALNKPVEELNVITCHLGNGGSVTAVRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIVFHLHDSLGMSVEQINKLLTKESGLLGLTEVTSDCRYVEENYMSKEDAK
RAMDVYCHRLAKYIGAYCALMEGRLDAVVFTGGIGENAAMVRELTLNKLGLLGFEVDHER
NLAARFGNGGNISKDGSRPALVIPTNEELVIAQDALRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttcttaactgtggtagttcatctctgaagtttgccatc
atcgatgcgattaacggggaggaatacctgtctggtctggccgagtgtttccaccttcct
gaagcccgtatcaaatggaaaatggatgggggtaaacaagaagccgcactgggtgctggc
gctgctcacagcgaggcgctgaacttcatcgttaataccattctttctcaaaaaccagaa
ctgtccgagcaactggttgccattggccatcgtattgttcacggcggtgaaaaattcact
cagtccgcgatcattaatgatagtgtcttgcaaggtatcaaggaagccataccttttgca
ccactgcataacccggcccacctgatcggcatcgcagaagcactgaagtcgttccccaaa
ttgactgataaaaatgtggccgtattcgataccgccttccatcagacaatgccggaagaa
tcctatctttatgcactgccgtacaaactgtataaagaccaccatatccgccgttacggc
gcacacggcaccagccactactttgtgactcaacgtgcggctgaagcgctgaacaaaccg
gtagaagaactgaacgtcattacctgtcacctaggtaatggcggttccgttaccgcggta
cgtaacggtaaatgtgttgatacgtctatgggtcttaccccgctggaaggtctggtgatg
ggtacccgtagtggcgatatcgacccagcgatcgttttccacctgcatgattcactgggc
atgagcgtagagcaaatcaacaaactgctgaccaaagaatccggcctgttaggtctgacc
gaagtcaccagcgattgccgctacgttgaagaaaactatatgtccaaagaagacgctaaa
cgcgcaatggacgtatattgccatcgcttggctaaatacatcggcgcatactgcgcgctg
atggaaggccgtttggatgctgttgtcttcaccggcggtattggtgaaaacgccgccatg
gtacgtgaactgacgctgaacaaactgggtctgttgggctttgaagtcgatcacgaacgt
aacctggcagcccgttttggcaacggcggtaatatctccaaagacggcagccgcccagcg
ctggttattccaaccaatgaagaattggttatcgctcaagacgccctccgtctgacagcg
taa

DBGET integrated database retrieval system