KEGG   Brenneria goodwinii: AWC36_05955Help
Entry
AWC36_05955       CDS       T05061                                 

Definition
(GenBank) O-acetylhomoserine aminocarboxypropyltransferase
  KO
K01740  O-acetylhomoserine (thiol)-lyase [EC:2.5.1.49]
Organism
bgj  Brenneria goodwinii
Pathway
bgj00270  Cysteine and methionine metabolism
bgj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AWC36_05955
Enzymes [BR:bgj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.49  O-acetylhomoserine aminocarboxypropyltransferase
     AWC36_05955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 FCD
Motif
Other DBs
NCBI-ProteinID: ATA23685
UniProt: A0A250BC64
Position
complement(1328271..1329569)
Genome map
AA seq 432 aa AA seqDB search
MASLKFETLQLHAGQQPDPTTGARAVPIYQTTSYAFENAQQGADRFALREFGNIYTRIQN
PTTDVFEKRIAALEGGVAALAVASGQAAQFIALNNILQAGDNFVSSPSLYGGTWTQFNLS
FKRLGVEVRIAKDDNAVSFESLINENTKALYLETIGNPRLGFPDFDHFAELAQKYHLPLV
VDNTFAAGGYLFRPLEHGAHVVVESATKWIGGHGNSIGGVIVDGGNYPWGNGKFPQFSTP
SAAYHGLVYNEVFGPGSELGNIQFIIRARVEGLRDFGPTLSPFNAFLLLQGLETLSLRVE
RHVDNALELARWLEKHPEVESVNYPGLPSSPAYDTAHKYLTKGFGSVLSVEISGGKARAS
RFINSLRLITHLANVGDAKTLIIQPSATTHQQLSDEQQISAGVTPAGLRFSVGIEHIDDL
KADIEQAFKASK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgttaaaattcgaaaccttgcaacttcatgccggccaacagcccgatcccacg
accggggctcgggccgtgcctatctatcagacaacctcctatgctttcgaaaatgcccag
cagggcgcggatcggttcgcattgcgtgaattcggcaatatctatacccggattcaaaat
cccaccactgacgtttttgaaaagcgcatcgccgcactggaaggcggcgttgccgcgctg
gcggtggcatccggtcaggctgcgcaatttatcgcgctgaacaatatattgcaggcgggc
gataatttcgtctcctcgccttcgttgtatggcggcacctggacgcagttcaatctctcg
tttaagcgcctgggcgtggaagtccgtatcgccaaagatgataacgcggtgagtttcgaa
agcctgattaatgaaaataccaaagcgctttatcttgaaaccatcggtaatccgcgtctg
ggcttccctgatttcgaccatttcgccgaattggcgcaaaaatatcacttacccctggtg
gtcgataatacctttgccgccggcgggtatctttttcgcccccttgagcatggcgcgcac
gtggtggtggagtccgccaccaaatggatcgggggccatggcaacagtatcggcggcgtg
atagtggatggcggcaactatccgtggggaaacgggaaattcccgcaattctccacgcca
tcggcggcgtatcatggtctggtatataacgaggttttcggccccggcagtgaattgggc
aacattcagtttattatccgcgccagggtcgaaggtctgcgtgatttcggcccgacgctg
tcgccttttaacgcctttttgctcctgcaagggctggaaacgctctctctgcgggtagag
cggcatgttgataacgcattggaactggcccgctggctggaaaaacatccggaagtggaa
agcgtgaattatccgggcctaccctccagtccggcatacgatacggcccataaataccta
acaaaagggtttggcagcgtgctgtccgtggaaatcagcggcggcaaagcgcgcgccagc
cggtttatcaacagcctgcggctgattacgcacctggctaacgttggcgacgccaagacc
ttgattatccagccttcggccactacccaccagcagttgagcgacgaacagcaaatatcc
gccggcgtcacgccggccgggctgcgcttctcggtggggattgagcatatcgacgatctg
aaggcggacatcgaacaggcgttcaaggccagtaaataa

DBGET integrated database retrieval system