KEGG   Brenneria goodwinii: AWC36_13505Help
Entry
AWC36_13505       CDS       T05061                                 

Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
bgj  Brenneria goodwinii
Brite
KEGG Orthology (KO) [BR:bgj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bgj03009]
    AWC36_13505
Enzymes [BR:bgj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     AWC36_13505
Ribosome biogenesis [BR:bgj03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AWC36_13505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: ATA25056
UniProt: A0A0G4JQ47
Position
complement(3076185..3077285)
Genome map
AA seq 366 aa AA seqDB search
MNKVILYCRPGFEKECAAEITEKTAQHNVYGFVRVKDNSGYVIFECYQHEDADRLLKDLP
FHELIFARQMFVGGELLRDLPPEDRITPIVGMLTGAVERAGDLRVEVPDTNESKELMKFC
RKFTVPLRAALRENKILLGYEKADRPVLHVLFIAPGCCYVGYSYSNNNSPFYMGIPRLKF
PSEAPSRSTLKLEEAFHVFVPADEWDERLASGMYAVDLGACPGGWTYQLVKRSMMVHAVD
NGPMASSLMDTGQVIHHQADGFRFEPPRNNVYWLVCDMVEKPAKVTSLIADWLVKGWCRE
AIFNLKLPMKKRYEEVSQNLALLRERLEENGINAEVHAKQLYHDREEVTVHVRRFWAAVP
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagttattttgtactgccgtccgggatttgaaaaagagtgcgcggcggaaata
accgagaagaccgcgcagcataacgtctatggttttgtccgggtgaaggataacagcggt
tatgtgatcttcgagtgctaccagcatgaagacgccgatcggctgctcaaagatctgccg
tttcatgagttgatttttgcccggcagatgttcgtcggcggcgaactgttgcgcgacctg
ccgccggaagatcgcatcactcccattgtcggcatgctgacgggcgcggttgagcgggcg
ggcgacctacgggtcgaagtccctgataccaacgaaagcaaggaactgatgaagttctgc
cgcaagtttaccgtgcctttacgcgccgccctgcgtgaaaataaaattctgctgggctat
gagaaagccgatcggccggtgctgcatgtgctgtttatcgcgccgggctgttgttacgtg
gggtactcctacagcaacaacaattcgccgttttatatggggattccccgcctgaagttc
ccctcggaggcgcccagccgttcgacgttaaagctcgaagaggcttttcacgttttcgtt
ccggccgatgaatgggatgagcgccttgccagcggtatgtacgccgtcgatctgggcgcc
tgtcccggcggttggacttatcaactggtaaaacgcagcatgatggttcatgccgtggat
aacggcccgatggcgtccagcttgatggataccgggcaggttatacatcatcaggccgat
ggttttcgtttcgaaccaccgcgtaataacgtgtattggctggtgtgcgacatggtggaa
aaaccggccaaagtcaccagtctgattgccgattggctggtaaaaggctggtgcagagag
gcgatctttaacctcaaactgccgatgaagaaacgctatgaggaagtttcgcagaacctg
gcgttactccgcgagcggctggaggaaaatggcattaatgcggaagtgcatgccaaacag
ctttaccatgaccgcgaagaggtcaccgtccatgttcgccgtttctgggctgcggtgccg
ggccggcgcgatgagcgataa

DBGET integrated database retrieval system