KEGG   Brenneria goodwinii: AWC36_23055Help
Entry
AWC36_23055       CDS       T05061                                 

Definition
(GenBank) diaminohydroxyphosphoribosylaminopyrimidine deaminase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bgj  Brenneria goodwinii
Pathway
bgj00010  Glycolysis / Gluconeogenesis
bgj00020  Citrate cycle (TCA cycle)
bgj00620  Pyruvate metabolism
bgj01100  Metabolic pathways
bgj01110  Biosynthesis of secondary metabolites
bgj01120  Microbial metabolism in diverse environments
bgj01130  Biosynthesis of antibiotics
bgj01200  Carbon metabolism
Module
bgj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bgj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWC36_23055
   00020 Citrate cycle (TCA cycle)
    AWC36_23055
   00620 Pyruvate metabolism
    AWC36_23055
Enzymes [BR:bgj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AWC36_23055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ATA26746
UniProt: A0A250BKZ6
Position
5286830..5288362
Genome map
AA seq 510 aa AA seqDB search
MSAIRVIEVPKWGLSMEEGTLNVWLIKEGDSFTAGQEVCEIESSKITNVLEAPFAGVLRR
ILVQPGETVPVSAPLALAADADVSDDDIDRFVAELQGSGGTDNSSSPQAVTPPPQTSSPA
PPVAVAPVAEVKKAHSAAATSTAYQVPSQLLGDGGADSFATPRARRLATYLAIDLSKVAG
SGRNGRISLADIDAAIVQHGGKVKAPERQVRAQRQPGSRQDDSQVAATPVARRLAARLGI
NLHDCRATGSRGRVCQTDVEQAAAHLAIPAAGNTAQGETATPEYEVTAMSGMRRAIASRL
QESKRNAPHFRLQVDLALDRLLALRKEINAAVPAVKLSVTDMLIKACALALVKVPGVNAL
FDQDRQEIQQYHDADISIAVALPAGLITPIVRAANRKTLTEIAGEMLTLVTKAKAGTLKP
EEFQGGTFSISNLGMHGVRQFDAIINPPQVAILAIGAGERRVVAEQDQMVVRTLMSVTLS
CDHRVVDGASGAEFLNQLKHLVENPATLLV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccattcgggtaatcgaagtacctaagtggggactgtcgatggaagagggaacg
cttaatgtctggctgattaaagagggagacagtttcactgccgggcaagaggtttgcgag
attgaatccagcaagatcaccaacgtgctggaagcaccctttgccggcgtgttgcggcgt
attctggtgcagccgggcgagacggtgccggttagcgcgccgctggcgctggcggctgac
gccgatgtcagcgacgatgatatcgatcgttttgttgccgaattgcaaggcagcggcggc
acggataattcatcgtcgccacaggctgtgacaccgccgccgcaaacgtcatcgccggca
ccgcccgtcgcggtagcgccggtcgccgaggttaaaaaagcgcatagcgcggcggcaacg
tccaccgcttatcaggtgccgtcgcaactgcttggcgacggcggcgcggatagttttgcg
acgccgcgggcgcggcgtctggcgacctacctcgctatcgatctgagcaaggtggccggc
agtggacggaacggtcgcatttcgctagccgatattgatgcggccatcgtgcagcatggc
ggcaaggtgaaagcaccggagcggcaggtacgcgcgcagcggcaacccggctcacgccag
gatgactctcaggtggcggcgacgccggtcgcccgccggctggcggccaggctgggtatt
aatctgcacgattgccgggcaaccggcagccggggccgggtatgccagacggatgtcgaa
caggcggccgcacatttggctattccggcggcggggaatacggcgcaaggagaaacggcg
acgccggagtatgaagttaccgccatgagcggcatgcgacgggccattgcctctcgcttg
caggagtccaaacgcaatgcgccgcatttccgtctgcaagtggatttggcgcttgatcgt
ctgctggcgttgcgtaaagagatcaatgccgctgtgccggcggtcaaactctcagtcacc
gatatgctgatcaaagcctgcgctctggcgctggttaaggttcccggcgtcaatgcgctg
ttcgatcaggatcgtcaggagatccaacagtaccacgatgcggacatttcgatcgcggtg
gcgctgcccgccggtctgatcaccccgattgtgcgggcggcgaatcgcaaaacgctgacc
gagatcgccggggaaatgttgacgctggtgaccaaggccaaagcgggaaccctgaagccg
gaagagttccagggcggcacgttcagcatttccaaccttgggatgcacggcgtgcgccag
ttcgacgccattatcaatccgccgcaggtcgcgattctggcgatcggcgccggcgagcgc
cgtgtggtggcggaacaggatcagatggtggtgcgcacattgatgagcgtcacgctatcc
tgcgaccatcgggtggtcgatggcgccagcggcgccgagtttcttaaccaactcaagcat
ctggtggaaaatcccgccacgttgcttgtatag

DBGET integrated database retrieval system