KEGG   Burkholderia glumae BGR1: bglu_1g00880Help
Entry
bglu_1g00880      CDS       T00905                                 

Definition
(GenBank) lysine-arginine-ornithine-binding periplasmic protein
  KO
K10013  lysine/arginine/ornithine transport system substrate-binding protein
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl02010  ABC transporters
Module
bgl_M00225  Lysine/arginine/ornithine transport system
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    bglu_1g00880
Transporters [BR:bgl02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter [MD:M00225]
    bglu_1g00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 NMT1 Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: ACR27291
UniProt: C5A882
Position
1:94252..95043
Genome map
AA seq 263 aa AA seqDB search
MNRWNPRAALALAAALACGGAFAAQPQATLRFGVEAQYAPFESKAADGTLQGFDIDLGNA
VCRLAQLSCQWVEASFDGLIPALQGRKFDAINSAMNATAQRRQAIAFTTIIYRVPTQLIA
RTASGLLPTAASLAGKRVGVLQGSIQEAYANAHWANAGVAVLAYQDQSQVYADLVAGRLD
ATLVLAPAGQRGFLSRPDGKGFGFVGQPVRDDRMLGSGIGFGLREGDDALKARLDGAIER
LKADGTVQALGRKYFGAIDISAQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgatggaacccgcgcgcggcgctcgcgctggccgctgcgctcgcctgcggcggc
gcctttgcggcgcagccgcaggccacgctgcgcttcggcgtggaggcgcagtatgcgccg
ttcgaatcgaaggcggccgacggcacgctgcagggcttcgacatcgatctcggcaatgcc
gtgtgccggctcgcgcagctgtcgtgccaatgggtcgaggcctcgttcgacgggctgatt
ccggcactgcaggggcgcaagttcgacgcgatcaattcggcgatgaacgccaccgcgcag
cgccgccaggcgatcgcgtttacgaccatcatctatcgcgtgccgacgcagttgatcgcg
cgcaccgccagcgggctgctgcccaccgccgcgtcgctcgcgggcaagcgggtgggggtg
ttgcagggctcgatccaggaggcctatgcgaacgcccactgggcgaacgcgggcgtggcg
gtcctggcctatcaggatcagagccaggtgtatgcggacctcgtcgcgggccgcctcgac
gccacgctggtgctggcgccggccggccagcgcggattcctgtcgcggcccgacggcaag
ggcttcggcttcgtcggccagccggtgcgcgacgaccggatgctcggcagcggaatcggc
ttcgggctgcgcgagggcgacgacgcgctgaaggcgcgcctcgacggcgcgatcgaacgg
ctcaaggccgacggcaccgtgcaggcgctcggccgcaagtacttcggcgcgatcgatatc
tcggcgcagtga

DBGET integrated database retrieval system