KEGG   Burkholderia glumae BGR1: bglu_1g01010Help
Entry
bglu_1g01010      CDS       T00905                                 

Definition
(GenBank) Glycine dehydrogenase
  KO
K00281  glycine dehydrogenase [EC:1.4.4.2]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00260  Glycine, serine and threonine metabolism
bgl00630  Glyoxylate and dicarboxylate metabolism
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01130  Biosynthesis of antibiotics
bgl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    bglu_1g01010
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bglu_1g01010
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     bglu_1g01010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDC-P Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACR27304
UniProt: C5A895
Position
1:complement(112162..115089)
Genome map
AA seq 975 aa AA seqDB search
MKLEHPDHLMNRTPLSLAALETHDAFAERHIGPDAASQQAMLDTLGFASRAALIDAVIPA
AIRRAETLPLGAFTQPKSEAEALAALRELAGKNQVFRSFIGQGYYHAHTPAVILRNVLEN
PAWYTAYTPYQPEISQGRLEALLNFQQMVTDLTGLAIANASLLDEATAAAEAMTLLQRNG
KPKSNRFFVADDVLPQTLEVIRTRAEPIGIEVATGPASQAAQADAFGVLLQYPGVNGDVH
DYRALADAVHAAGGHVVVAADLLALTVLAPPGEWGADVAVGNTQRFGVPVGFGGPHAAYL
AVRDEFKRQMPGRLVGVTVDAQGKPALRLALQTREQHIRREKATSNVCTAQALLAIMASS
YAVYHGPRGLKTIALRVNRIAALLDAGLKQLGYATVNATFFDTLTIEAGERAAALHEAAR
ARRINLRHAGATRVGVSIDETTTRADLADLLAIFAEVAGAAAPGVDALEAALPGHATLPA
GLERQSAYLTHPVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPV
TWPEFGQIHPFAPEEQTLGYREMIAQLEAMLVAATGYAAVSLQPNAGSQGEYAGLLIIHA
YHASRGEGHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDLADLKAKAEQHSAN
LAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTAPGQFGGDVSHLN
LHKTFCIPHGGGGPGVGPVAVGPHLAQFLPNQRSTGYARGEHGIGAVSAAPYGSASILPI
SWMYVAMMGARNLTAATEVAILNANYIAKRLAPHYPVLYSGPGGLVAHECILDLRPIKES
SGITVDDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESQEELDRFIDAMIAIREEIRAV
EEGRADREDNPLRHAPHTAAVVTANQWTHAYTREQAAFPVASLAGNKYWPPVGRADNVYG
DRNLFCACVPMSDYA
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgaacacccggatcacctgatgaaccgcacgcccctctcgctcgccgcgctc
gaaacccacgacgcgttcgccgaacgccacatcgggcccgacgccgccagccagcaggcc
atgctcgacacgctcggcttcgcctcgcgcgccgcgctgatcgacgcggtgatccccgcc
gcgatccgccgcgccgagacgctgccgctcggcgcgttcacgcagcccaagagcgaggcc
gaggcgctcgccgcgctgcgcgagctggccggcaaaaatcaggtgttccgctcgttcatc
ggccagggttactaccatgcgcatacgccggcggtgatcctgcgcaacgtgctcgagaac
ccggcctggtacacggcctacacgccgtaccaacccgaaatttcgcaggggcgcctcgag
gcactcctgaacttccagcagatggtgaccgacctcaccggcctcgcgatcgccaacgcg
tcgctgctcgacgaggcgaccgccgcggccgaggcgatgacgctgctgcagcgcaacggc
aagccgaagtcgaaccggttcttcgtcgccgacgacgtgctgccgcagacgctcgaggtg
atccgcacgcgcgccgaaccgatcggcatcgaggtggcgaccgggccggcctcgcaggcc
gcccaggccgatgcgttcggcgtgctgctgcaatacccgggcgtaaacggcgacgtgcac
gactaccgcgcgctcgccgacgccgtgcatgccgcaggcggccacgtggtggtggcggcc
gacctgctcgcgctgacggtgctcgcgccgccgggcgaatggggcgcggacgtggcggtg
ggcaacacccagcgcttcggcgtgccggtgggcttcggcggcccgcacgcggcctacctc
gcggtgcgcgacgaattcaagcgccagatgccggggcgcctggtgggcgtgaccgtcgac
gcgcagggcaagcccgcgctgcgcctcgcgctgcagacgcgcgagcagcacatccgccgc
gagaaggccacctcgaacgtctgcaccgcgcaggcgctgctggcgatcatggccagctcc
tacgccgtctaccacggcccgcgcggcctgaagacgatcgcgctgcgcgtgaaccggatc
gccgcgctgctcgacgcgggcctcaagcagctcggctacgccaccgtcaacgccaccttc
ttcgacacgctgacgatcgaggcgggcgagcgcgccgccgcgctgcacgaagccgcgcgc
gccaggcgcatcaacctgcgccatgccggcgcgacgcgcgtgggcgtgtcgatcgacgaa
accaccacgcgcgccgacctggccgacctgctggcgatcttcgccgaggtggcgggcgcc
gcggcgcccggcgtcgacgcgctggaagccgcgctgcccggccacgccacgctgccggcc
ggcctcgagcgccagagcgcctacctcacgcacccggtgttcaatcgccaccattccgaa
acggaaatgctgcgctacctgcgcagcctgtccgacaaggatctcgcgctcgaccgttcg
atgatcccgctcggctcctgcaccatgaagctcaacgccacctcggagatgctgcccgtg
acctggcccgagttcggccagatccatccgttcgcccccgaggagcagacgctcggctat
cgcgagatgatcgcccagctcgaagcgatgctggtggccgccaccggctacgcggccgtg
tcgctgcagccgaatgcgggctcgcagggcgagtacgccggcctgttgatcatccacgcc
tatcacgcctcgcgcggcgagggccatcgcgacgtctgcctgatcccggcctcggcgcac
ggcaccaacccggcctcggcgcacatggccggcatgaaggtggtggtggtggcctgcgac
gcgcagggcaacgtcgacctggccgacctgaaggccaaggccgagcagcactcggcgaac
ctcgcggcgatcatgatcacctacccgtccacccacggcgtgttcgagcagaacgtgcgc
gagatttgcgagatcgtgcatgcgcacggcggccaggtctacgtggacggcgcgaacatg
aacgcgatggtcggcctgacggcgccgggccagttcggcggcgacgtgtcccacctgaac
ctgcacaagacgttctgcatcccgcacggcggcggcggccccggcgtcggcccggtcgcg
gtcggcccgcacctcgcgcaattcctgccgaaccagcgctcgaccggctacgcgcgcggc
gagcacggcatcggcgccgtgtcggccgcgccgtatggctcggcctcgatcctgccgatc
tcgtggatgtacgtcgcgatgatgggcgcgcgcaacctgacggccgccaccgaggtggcg
atcctcaacgcgaactacattgccaagcgcctcgcgccgcattacccggtgctctactcg
ggccccggcggcctggtcgcgcacgaatgcattctcgacctgcggccgatcaaggaatcg
agcggcatcaccgtcgacgacgtcgccaagcgcctgatggactacggcttccacgcgccg
accatgagcttcccggtgccgggcacgctgatggtcgagccgaccgaatcggaatcgcag
gaggagctggaccgcttcatcgacgcgatgatcgcgatccgcgaggaaatccgcgccgtc
gaggagggccgcgccgaccgcgaggacaatccgctgcgccatgcgccgcacaccgccgcg
gtggttaccgccaaccagtggacgcatgcctacacgcgcgagcaggccgcattcccggtg
gcctcgctggccggtaacaagtactggccgcccgtcgggcgcgcggacaacgtctacggc
gaccgcaacctgttctgcgcgtgcgtgccgatgtccgactacgcctga

DBGET integrated database retrieval system