KEGG   Burkholderia glumae BGR1: bglu_1g01020Help
Entry
bglu_1g01020      CDS       T00905                                 

Definition
(GenBank) Glycine cleavage system H protein
  KO
K02437  glycine cleavage system H protein
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00260  Glycine, serine and threonine metabolism
bgl00630  Glyoxylate and dicarboxylate metabolism
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01130  Biosynthesis of antibiotics
bgl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    bglu_1g01020
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bglu_1g01020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_H RnfC_N Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ACR27305
UniProt: C5A896
Position
1:complement(115151..115531)
Genome map
AA seq 126 aa AA seqDB search
MSNVPADLKYTDEHEWIRTEADGTLTIGITDHAQTTLGDIVFLELPQVGKHADAGDPVGV
VESVKAASDIYAPVSGEIIAINEDAVDTPESVNQDAYDAWLFKVRLAPGASTGALLDAQA
YKKLID
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgtcccggccgatctgaagtacaccgacgaacacgagtggatccgcaccgag
gcggacggcacgctgacgatcggcatcaccgatcacgcgcaaaccacgctcggcgacatc
gtcttcctcgaactgccgcaagtcggcaagcacgccgacgcgggcgacccggtgggcgtc
gtcgaatcggtgaaagccgcctcggacatctacgcaccggtgtcgggcgagatcatcgcc
atcaacgaggatgccgtcgacacgccggaatcggtcaaccaggacgcctacgacgcctgg
ctcttcaaggtcaggctcgcgccgggcgccagcaccggcgcgctgctcgacgcccaggcc
tacaagaagctgatcgactaa

DBGET integrated database retrieval system