KEGG   Burkholderia glumae BGR1: bglu_1g01070Help
Entry
bglu_1g01070      CDS       T00905                                 

Definition
(GenBank) UvrD/REP helicase
  KO
K03656  ATP-dependent DNA helicase Rep [EC:3.6.4.12]
Organism
bgl  Burkholderia glumae BGR1
Brite
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     bglu_1g01070
DNA repair and recombination proteins [BR:bgl03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA helicases
    bglu_1g01070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 Viral_helicase1 AAA_12 DEAD AAA_11
Motif
Other DBs
NCBI-ProteinID: ACR27309
UniProt: C5A8N0
Position
1:119754..121838
Genome map
AA seq 694 aa AA seqDB search
MSAGLNAAQSEAVRYLDGPCLVLAGAGSGKTRVITQKIAHLIENKGFEPRHIAAVTFTNK
AAAEMRERVGKLLEGKTLTTPGKEGRKVPVNQLTVCTFHSLGVQILRQEAEHVGLKPQFS
IMDSDDCFGMVQEQIGTTDKGLIRKIQNIISLWKNGLISPEEAMTIAANEDEHQAALVYR
NYVATLHAYQAVDFDDLIRLPTELFASNEQVRDRWQNKLRYLLIDEYQDTNACQYQLLKL
LAGPRAAFTAVGDDDQAIYGWRGATLENLAQLGKDFPKLHLVKLEQNYRSTVRILTAANN
VIANNPKLFEKKLWSEHGMGDTITVTPCNDEEHEAESVVFRLSAHKFERRTQFRDYAILY
RGNFQARIFEQVLRRERIPYVLSGGQSFFDKAEIKDLCAYLRLIANPDDDPAFIRAVTTP
RRGIGNTTLEALGSFAGQAKVSLFEAVYMGGIEARLSARQVEPLRVFCDFIQRLTDRADK
EPASVVLDDMMEAIHYEAYLYDAFDERQAQTRWQNVLEFLEWLKRKGTKPETEAVDGEAE
GFHNADGLADTGKNLLGLIQTVALMSMLEGKDEDPDAVRLSTVHASKGLEYPHVFLVGVE
EGVMPHRGSSEDDAIDDERIEEERRLMYVAITRAQRSLHLNWCKKRKRARETIVCEPSRF
IAEMGLDEAPPPTPEEAPMTPKDRLASLKALLQK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaggtctcaatgccgctcaaagcgaagcggtgcgctatctcgacggtccctgc
ctcgtgctcgccggcgccggcagcggcaagacgcgcgtgatcacgcagaagatcgcccat
ctgatcgagaacaagggtttcgagccgcgccacatcgcggccgtgacgttcaccaacaag
gccgccgccgaaatgcgcgagcgcgtgggcaagctgctggaaggcaagacgctcaccacg
cccggcaaggaaggccgcaaggtgcccgtcaaccagctcacggtctgcaccttccattcg
ctcggcgtacagatcctgcgccaggaggccgagcacgtcgggctcaagccgcagttctcg
atcatggattcggacgactgcttcggcatggtgcaggagcagatcggcaccaccgacaag
ggcctgatccgcaagatccagaacatcatctcgctctggaagaacggcctgatctcgccc
gaggaggccatgacgatcgccgccaacgaggacgagcatcaggccgcgctcgtctaccgc
aactacgtggcgacgctgcacgcctatcaggcggtcgatttcgacgacctgatccgcctg
cccaccgagctgttcgcgagcaacgagcaggtgcgcgaccgctggcagaacaagctgcgc
tatctgctgatcgacgaataccaggacaccaacgcctgccagtaccagctgctcaagctg
ctggccggcccgcgcgcggcgttcacggcggtcggcgacgacgaccaggcgatctacggc
tggcgcggcgccacgctggagaacctcgcccagctcggcaaggactttccgaagctgcac
ctggtcaagctcgagcagaactatcgctcgacggtgcggatcctgaccgcggcgaacaac
gtgatcgccaataatccgaagctgttcgagaagaagctgtggtccgagcacggcatgggc
gacacgatcaccgtcacgccctgcaacgacgaggagcacgaggccgaatcggtggtgttc
cggctgtcggcgcacaagttcgagcggcgcacccagttccgcgactacgcgatcctctat
cgcggcaacttccaggcgcgcatcttcgagcaggtgctgcgccgcgagcggattccctac
gtgctgtcgggcggccagtcgttcttcgacaaggccgagatcaaggacctgtgcgcctat
ctgcgcctgatcgccaaccccgacgacgatcccgccttcatccgcgccgtcaccacgccg
cgccgcggcatcggcaacaccacgctggaggcgctcggctcgttcgcggggcaggccaag
gtgtcgctgttcgaggccgtctacatgggcggcatcgaggcgcggctgtcggcgcggcag
gtcgagccgctgcgcgtgttctgcgatttcatccagcgcctcaccgatcgcgccgacaag
gagccggcctccgtggtgctcgacgacatgatggaggcgatccactacgaggcctatctc
tacgacgcattcgacgagcgccaggcgcagacgcgctggcagaacgtgctggaattcctc
gaatggctcaagcgcaagggcaccaagcccgagaccgaggcggtggacggcgaggccgaa
ggcttccacaacgccgacgggcttgccgacaccggcaagaacctgctcgggctgatccag
accgtcgcgctgatgtcgatgctcgagggcaaggacgaggaccccgacgcggtgaggctg
tccaccgtgcatgcctcgaaggggctcgaatatccgcacgtattcctggtgggcgtcgag
gaaggcgtgatgccgcaccgcggcagctcggaggacgacgcgatcgacgacgagcggatc
gaggaggagcgccgcctgatgtacgtggcgatcacgcgcgcgcaacgcagcctgcatctg
aactggtgcaagaagcgcaagcgcgcgagggagacgatcgtctgcgagccgtcgcgcttc
atcgccgagatggggctcgacgaggcgccgccgcccacccccgaggaggcgccgatgacg
ccgaaggaccggctggccagcctgaaggcgctgctgcagaagtga

DBGET integrated database retrieval system