KEGG   Burkholderia glumae BGR1: bglu_1g01220Help
Entry
bglu_1g01220      CDS       T00905                                 

Definition
(GenBank) Fels-2 prophage protein
  KO
K06905  uncharacterized protein
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    bglu_1g01220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD
Motif
Other DBs
NCBI-ProteinID: ACR27324
UniProt: C5A8P5
Position
1:complement(131255..132337)
Genome map
AA seq 360 aa AA seqDB search
MPANSNSRTPDERRRMARVEREPDYRITIAGRDISKRFAPRLQSLTVTESRSEEADTVDI
VLDDARGDIALPKRGQEIKVSIGWAGSTLIDKGTFIINEFEYAGAPDTITVRARSAAMRD
GMQERREKSWHKQTIGAIVKSIAARYSLAPAIGDTLAKIAIAHIDQTQESDMSFLTRLAK
RYDAVMNVKDKRLLFMPIGTGKTASGKPLDELAIVRKDGDSHRYHVSERENYNAVRAHYH
SNGHGRRKSVIVGGENNHNVKVLPEDYATKEEAMAAAQAEYNRTQRSQQTLSYSLAWGRP
EVFPEMPVTVAGLKPEIDEAAWIVKRATHTLDDSGLVTDLDLEMRDDPTTDRHRSHLGKR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgaattccaacagccgcacccctgatgaacgccggcgcatggcgcgtgtcgag
cgcgaacccgattaccggatcacgatcgccggccgcgatatctccaagcgcttcgcgccc
cggctccagtcgctcacggttaccgaatcacgctcggaggaggccgataccgtcgacatc
gttctggacgatgcccgcggcgacattgcgctgcccaagcgcggccaggaaatcaaggtg
tcgatcggctgggccggatcgacgctgatcgacaaaggcaccttcatcatcaacgaattc
gagtacgccggcgcgccggacacgatcaccgtgcgtgcgcgctcggcggccatgcgcgac
ggcatgcaggaacgtcgggaaaagagctggcacaagcagacgatcggcgcgatcgtcaag
agcatcgcggcgcgttactcgctggcgccggcgatcggcgacacgctcgcgaagatcgca
attgcgcacatcgaccagacgcaggagtcggacatgtcgttcctgacgcgcctcgcgaaa
cggtacgacgcagtgatgaacgtgaaggacaagcggctgctgttcatgccgatcgggaca
ggcaagaccgcgagcgggaagccgctcgacgagctggcgatcgtgcgaaaggacggagac
agccaccgctaccatgtgtcggagcgcgagaactacaacgccgtgcgcgcgcactatcac
agcaacggccacggccggcgaaagtcggtcatcgtgggcggcgagaacaatcacaacgtg
aaagtgctgccggaagactatgcgacgaaagaagaagcgatggcggccgcgcaggcggaa
tacaaccgcacgcagcgcagccagcagacccttagctattcgctcgcttggggccggccg
gaagtgttccctgaaatgcccgtgactgtcgccggactgaagccggaaatcgacgaggcg
gcctggatcgtcaagcgggctacccacaccctggacgatagcggcctggtcacggacctg
gatctagaaatgcgcgacgacccaaccaccgaccggcaccgcagccacttagggaagcgc
tga

DBGET integrated database retrieval system