KEGG   Burkholderia glumae BGR1: bglu_1g01290Help
Entry
bglu_1g01290      CDS       T00905                                 

Definition
(GenBank) Bacteriophage-acquired protein
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Caudo_TAP
Motif
Other DBs
NCBI-ProteinID: ACR27331
UniProt: C5A8Q2
Position
1:complement(138294..138929)
Genome map
AA seq 211 aa AA seqDB search
MLVHHYNPTTGEYLSSGQPDADPLNNDRWLIPSNATLDAPPPRAATSWPFYRDGAWFLLP
DYRGRRCYRTDTGEPVEIAVAGKTPDELGLTDIPRPSPRHAWVDGAWVVPDSVIEAEKRA
ARQQTFDQLMANAKKANDGKADAYAAGLLDDEGIYYFKAWSAYQMALVAAMNSTDASATI
TWPKTPAPYVAPVAEVAPQDVTPPEAPTKSA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgctcgttcaccactacaacccgaccaccggcgaatacctgtccagcggccagccggac
gccgacccgctcaacaacgatcgctggctgatcccatcaaacgcaacgctcgacgcaccg
ccgccgcgcgcggcaacgagctggccgttctaccgcgatggcgcctggtttctgcttccc
gactatcgcggccgccgctgctatcgcaccgacaccggcgaaccggtcgaaatcgccgtc
gcgggcaagacgcccgacgagctgggcttgacggacatcccgcgcccgtccccgcggcat
gcgtgggtcgacggcgcgtgggttgtccccgattccgtcattgaagcggagaagcgcgca
gcgcggcagcagacgttcgaccagctcatggcaaatgcgaagaaggcaaacgacggaaag
gccgacgcttacgccgccggcctgctcgacgacgaaggcatctattacttcaaagcctgg
tccgcttaccagatggcactagtggccgccatgaacagcacggacgcttccgccaccatc
acctggccgaaaacgccagcgccgtatgtcgcgcccgtggccgaagtggcgccgcaagac
gtgacaccgcccgaggcaccgaccaagagcgcgtaa

DBGET integrated database retrieval system