KEGG   Burkholderia glumae BGR1: bglu_1g01340Help
Entry
bglu_1g01340      CDS       T00905                                 

Definition
(GenBank) bacteriophage baseplate assembly protein V
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_base_V Phage_Mu_Gp45 Phage_fiber_2
Motif
Other DBs
NCBI-ProteinID: ACR27336
UniProt: C5A8Q7
Position
1:complement(143333..144031)
Genome map
AA seq 232 aa AA seqDB search
MDANETHRKARNAVRKGSILDIDHANALCRVAVGESDDDGLQTNWIPWIAGSAGTTRDWL
PPTRGEQVVLLCPMGDPAQAVALRGFYSDAAPAPDASPNTHTRVYPDGARVTYDHAGHSL
VAELPAGATVRIVAPVSVTVETKAATIKADTATIDAANTTCTGSLTVKGPFAFESGMTGK
GGTEGGRGSVMRIDGSAAFTGDVTAGQVSLQSHKHQAQGENAITSQPISGAA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaacgaaactcaccgcaaagcgcgcaacgccgttaggaagggatcgatactc
gatatcgaccacgcgaacgccttgtgccgcgtcgcagtcggcgaatcagacgacgacggc
ctgcaaacgaactggattccctggatcgcgggctcggctggcaccacgcgcgattggctt
ccaccgacgaggggtgagcaggtcgtgttgctctgcccgatgggagacccggcacaggcc
gtcgccttgcgcggcttctattcggacgcggcgccggcgcccgacgcctcgccgaacacg
catacgcgcgtctatccggacggcgcgcgcgtgacgtatgaccatgccggccactcgctc
gtggccgagctgccggcgggcgcgacggtgcgcatcgtcgcgcccgtatccgtcacggtc
gaaacgaaggccgccacgatcaaggcagacacggcgaccatcgatgccgcgaacacgacc
tgcaccggctcgctcacggtcaagggtccatttgcgttcgaatcgggcatgaccggcaag
ggcggcaccgaaggcggccgcggctccgtgatgcgaatcgacggctcggccgcctttact
ggcgatgtcaccgccggccaggtcagtctgcaatcgcacaagcaccaggcacaaggcgaa
aacgcgattaccagccagccgatctcaggtgccgcatga

DBGET integrated database retrieval system