KEGG   Burkholderia glumae BGR1: bglu_1g01490Help
Entry
bglu_1g01490      CDS       T00905                                 

Definition
(GenBank) Gp5, phage portal protein, pbsx family
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_portal p450
Motif
Other DBs
NCBI-ProteinID: ACR27351
UniProt: C5A8S2
Position
1:153039..154094
Genome map
AA seq 351 aa AA seqDB search
MSKRRSRAPRTFAAAPDSGAAGAAPARAEVFTFDDPTPVMNRAEILDYVECWSNGDWFEP
PVSFAGLAKSFRASTHHSSALYFKANVLASTFRPHRWLSRNAFERWALDFLTFGNGYLER
RRNQLGDTLRLEPALAKYTRRKADFSGFVYVNGWQDKHEFEPGSVFQLMRPDINQEVYGL
PEYLSSLHSAWLNESSTLFRRKYYENGSHAGFILYMTDAAQKQEDVDNMRTALKNAKGPG
NFRNVFMYAPGGKKDGIQLIPVSEVAAKDEFFNIKNVTRDDLLAAHRVPPQLLGIVPSNS
GGFGTPDTAARVFGRNEIKPLQARFAELNDWLGEEVVSFDDYEIPPAPVDA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgccgatcgcgcgcgccgcgcacgttcgcggccgcgccggattcgggcgcc
gccggcgccgcgccggcgcgcgccgaggtcttcaccttcgacgatcccacgccggtcatg
aaccgggccgagattctcgattacgtcgaatgctggtcgaacggcgattggttcgagccg
cccgtcagcttcgccggcctggcgaaatcgttccgcgccagcacgcaccacagctcggcg
ctgtatttcaaggcgaacgtgctggcgtcgacgttccggccacataggtggctgtcgcgg
aatgcgttcgagcgatgggcgctcgacttcttgacgttcggcaacggctacctggaacgc
cgccgcaatcagctcggcgacacgctgcggctggaacccgccctggcgaaatacacacgg
cgcaaggcagatttcagcggcttcgtgtacgtcaacggctggcaggacaagcacgagttc
gagccgggcagcgtgttccagctcatgcgaccggacatcaaccaggaggtgtacggcctg
cccgaatatctcagctcgcttcactcggcctggctgaacgagtcgtcgacgctgttccgc
aggaagtattacgaaaacggcagccatgcgggcttcatcctgtacatgacggacgcggcg
cagaaacaggaggatgtcgacaacatgcgcacggcgttgaagaacgcgaaggggccgggc
aatttccgcaacgtgttcatgtacgcgccgggcgggaagaaagacggcatccagctcatc
ccagtgtcggaggtcgcggcgaaggacgagttcttcaacatcaagaacgtgacacgcgac
gaccttctcgccgcgcatcgcgtgccgccgcaactgctcggcatcgtgccgagcaactcg
ggcggattcggcacaccggacactgcggcgcgcgtgttcggccggaacgaaatcaaaccg
ctgcaggcgcgcttcgccgagctgaatgactggctcggcgaagaggttgtttcattcgat
gactacgagataccgccggcgccggtcgacgcatag

DBGET integrated database retrieval system