KEGG   Burkholderia glumae BGR1: bglu_1g01540Help
Entry
bglu_1g01540      CDS       T00905                                 

Definition
(GenBank) PAAR repeat-containing protein
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAAR_motif zf-FPG_IleRS
Motif
Other DBs
NCBI-ProteinID: ACR27356
UniProt: C5A8S7
Position
1:complement(159582..160115)
Genome map
AA seq 177 aa AA seqDB search
MGFAFIREGDTTMHGGRVLTYDPTHTVDGKPLALVGDMAACPRCGGVFPTVKVRTELNMT
FGGRAVACEGDMTACEATLIAFQGTATASPTSGPSGNAASSIGAGLSVLSQPASGGSKRG
RFQVLDDDTGRPVAGHPYTVTGSNGETGATDADGYTSWLQADQSSSLTFERSNSSLS
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggattcgcgttcattcgtgagggagacacgaccatgcacggcggccgtgtcctgacc
tacgatccgacacataccgtagacgggaagccgctcgcactggtcggagatatggccgct
tgccctagatgcggaggagttttcccgaccgtgaaggtacggaccgagttgaacatgact
ttcggcggccgcgccgtggcatgcgagggtgacatgacagcatgcgaagctacgctgatt
gcttttcagggaaccgccactgcatcgccgacctcgggaccgagcggcaacgcggcctca
tcaattggcgcagggctcagcgtgctttcgcagcctgcgagcggtggctcaaagcggggg
cgattccaggtattggacgacgacaccggccggccggtggccggccatccctacaccgtt
accggctcgaacggagagacaggggcaacggatgctgacggttacacgagctggttgcaa
gcggaccagtcgtcatcgttgacattcgaaaggtcaaactcgagcttgtcatga

DBGET integrated database retrieval system