KEGG   Burkholderia glumae BGR1: bglu_1g01570Help
Entry
bglu_1g01570      CDS       T00905                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K01501  nitrilase [EC:3.5.5.1]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00380  Tryptophan metabolism
bgl00460  Cyanoamino acid metabolism
bgl00627  Aminobenzoate degradation
bgl00643  Styrene degradation
bgl00910  Nitrogen metabolism
bgl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    bglu_1g01570
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    bglu_1g01570
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    bglu_1g01570
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    bglu_1g01570
   00643 Styrene degradation
    bglu_1g01570
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.5  In nitriles
    3.5.5.1  nitrilase
     bglu_1g01570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACR27358
UniProt: C5A8S9
Position
1:complement(163277..164200)
Genome map
AA seq 307 aa AA seqDB search
MPQSRIAALQIGASPLGKAETLQQILAFEDAIRAERLALVVMPEALLGGYPKGETFGTRL
GYRLPEGRDAFARYHGNAIDVPGPETDALAGLSARSGASLVTGVIERAGATLYCTALFFD
PAAGLVAAHRKLMPTGTERLIWGQGDGSTLPVVETAAGRAGAAICWENHMPLLRMAMYAK
GVEIWCAPTVDEREIWQSSMRHIAHEGRCFVVSACQVQPSPAALGIEVPGWDPQRPLING
GSVIVGPLGEVLAGPLVGETGLVITEVDTAELTRARYDFDVAGHYARPDVFTLAVDERPK
RSVVFHR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccccaatcccgcatcgccgcgctgcagatcggcgcctccccgctcggcaaggccgag
accttgcagcagatcctcgccttcgaggacgcgatccgcgccgagcggctggcgctggtg
gtgatgcccgaggcgctgctgggcggctatccgaaaggcgagacgttcggcacccggctc
ggctaccggctgcccgaaggacgcgacgcgttcgcgcgctaccacggcaacgcgatcgac
gtgccggggccggagaccgacgcgctggccgggctgtcggcacgcagcggcgcctcgctc
gtgaccggcgtgatcgagcgcgccggcgcgacgctgtactgcacggcgctgttcttcgac
ccggccgccggcctcgtcgcggcccaccgcaagctgatgccgaccggcaccgagcggctg
atctgggggcaaggcgacggctcgacgctgccggtggtggagacggcggccggccgtgcc
ggcgcggcgatctgctgggagaaccacatgccgctgctgcgcatggcgatgtacgcgaag
ggcgtagagatctggtgcgcaccgaccgtggacgagcgcgagatctggcagagctcgatg
cgccacatcgcgcacgaggggcgctgcttcgtggtgagcgcctgccaggtgcaaccgtcg
ccggccgcgctcggcatcgaggtgccgggctgggacccgcagcggccgctgatcaacggc
ggcagcgtgatcgtcgggccgctcggcgaggtgctggcggggccgctcgtcggcgagacc
gggctcgtgatcaccgaggtcgacaccgccgaactcacgcgcgcgcgctacgacttcgac
gtggccggccattacgcgcgccccgacgtgttcacgctggccgtcgacgagcgcccgaag
cgcagcgtggtgttccaccggtga

DBGET integrated database retrieval system