KEGG   Burkholderia glumae BGR1: bglu_1g01810Help
Entry
bglu_1g01810      CDS       T00905                                 

Definition
(GenBank) flagellar motor protein MotB
  KO
K02557  chemotaxis protein MotB
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl02030  Bacterial chemotaxis
bgl02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    bglu_1g01810
   02040 Flagellar assembly
    bglu_1g01810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgl02000]
    bglu_1g01810
   02035 Bacterial motility proteins [BR:bgl02035]
    bglu_1g01810
Transporters [BR:bgl02000]
 Other Transporters
  Pores ion channels [TC:1]
   bglu_1g01810
Bacterial motility proteins [BR:bgl02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    bglu_1g01810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotB_plug OmpA
Motif
Other DBs
NCBI-ProteinID: ACR27382
UniProt: C5A8V3
Position
1:188826..189875
Genome map
AA seq 349 aa AA seqDB search
MSKGKDRAIVVKRVAPAKKGHHGGAWKLAYADFMTAMMAFFLLMWLLSAVTPVQLKGIAD
YFNTPLKAALFGNGDRSSHDSSIIQGGGSDITRSDAGTTRRTDGTTMLASRLAQKGRDDL
HDTDPGSQDRAEQARLHDLQIKLMAAIEANPVLRQFKQQIRIDSTLSGLRIEIVDTQKRP
MFATASNMVEPYMRDILREIGKTLNEVPNRIVVQGHTDAVPYAGGEKGYSNWELSADRAN
ASRRELISGGMDDAKVLRVTGLASTQNLNKADPFDPENRRISILVLNHKSEVALMHDDAS
TTTLSNDAAGSQALSQQIAAPAKPAKPAAPAPVALPAVAAPARPAAHAQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagggcaaggatcgcgcgatcgtcgtcaaacgggtcgcgccagcgaagaagggg
caccacggcggtgcctggaagctcgcctacgcggacttcatgaccgcgatgatggcgttc
ttcctgctgatgtggctgctgtcggccgtcacgccggtgcagttgaagggcatcgccgat
tacttcaacacgccgctgaaggccgcgctgttcggcaacggcgaccgcagctcgcacgac
tcgagcatcatccagggcggcggctcggatatcacgcgcagcgacgccggcaccacgcgc
cgcaccgacggcaccaccatgctggccagccgcctggcgcagaagggccgcgacgacctg
cacgataccgatccgggttcgcaggatcgcgccgagcaggcgcggctgcacgacctgcag
atcaagctgatggccgccatcgaggcgaatccggtgctgcgtcagttcaagcagcagatc
cgcatcgactcgacgctctcggggctgcgcatcgagatcgtcgatacccagaagcgcccg
atgttcgccacggcgagcaacatggtcgagccctacatgcgcgacatcctgcgcgagatc
ggcaagacgctcaacgaggtgccgaaccgcatcgtggtgcagggccataccgacgcggtg
ccttatgccggcggcgaaaagggctacagcaactgggagctgtcggcggaccgcgcgaac
gcgtcgcggcgcgagctgatctcgggcggcatggacgatgcgaaggtgctgcgcgtgacc
ggcctggcctccacgcagaacctgaacaaggccgatccgttcgatccggagaaccgccgg
atcagcatcctggtgttgaaccacaagtcggaagtcgcgctgatgcacgacgacgcgagc
acgacgacgctgtccaacgacgcggccggttcgcaggcgctgtcccagcagatcgctgcg
ccggccaagcccgcgaagccggcggcgccggcgccggtggcgctgcctgccgtggcggcg
ccggcacggcctgccgcccatgcccaatga

DBGET integrated database retrieval system