KEGG   Burkholderia glumae BGR1: bglu_1g01840Help
Entry
bglu_1g01840      CDS       T00905                                 

Definition
(GenBank) chemotaxis protein CheW
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl02020  Two-component system
bgl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    bglu_1g01840
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    bglu_1g01840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bgl02035]
    bglu_1g01840
Bacterial motility proteins [BR:bgl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    bglu_1g01840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW
Motif
Other DBs
NCBI-ProteinID: ACR27385
UniProt: C5A8V6
Position
1:192637..193170
Genome map
AA seq 177 aa AA seqDB search
MSEVHSIQPAAAGAGASNRRDAAQADAAGQEFLVFTLGDEEYGIDILKVQEIRGYDSVTR
IANAPEFIKGVINLRGIIVPIVDMRIKFHLGRIDYDHQTVVIILNVAHRVVGMVVDGVSD
VLTLTADQVMPAPEFGATLTTEYLTGLGTVDGRMLILMDIEKLMTSREMALIDEFSA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaagtccattcgatccaaccggcggccgcgggcgcgggcgccagcaaccgccgc
gacgccgcccaggccgatgcggccggccaggaattcctcgtcttcacgctcggcgacgag
gaatacggcatcgacatcctgaaggtgcaggaaatccgcggctacgacagcgtcacgcgg
atcgccaacgcgcccgagttcatcaagggcgtgatcaacctgcgcggcatcatcgtgccg
atcgtcgacatgcgcatcaagttccatctcgggcgcatcgactacgaccaccagaccgtg
gtgatcatcctgaacgtcgcgcatcgcgtggtggggatggtggtggacggcgtgtccgac
gtgctgacgctgactgccgaccaggtcatgccggcgccggaattcggcgcgacgctgacc
accgagtacctgacgggcctcggcaccgtggacggccggatgctgatcctgatggacatc
gaaaagctgatgacgagccgcgagatggcgctcatcgatgagttcagcgcctga

DBGET integrated database retrieval system