KEGG   Burkholderia glumae BGR1: bglu_1g01980Help
Entry
bglu_1g01980      CDS       T00905                                 

Definition
(GenBank) flagellar biosynthesis sigma factor FliA
  KO
K02405  RNA polymerase sigma factor for flagellar operon FliA
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl02020  Two-component system
bgl02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    bglu_1g01980
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    bglu_1g01980
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bgl03021]
    bglu_1g01980
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bgl02035]
    bglu_1g01980
Transcription machinery [BR:bgl03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     bglu_1g01980
Bacterial motility proteins [BR:bgl02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    bglu_1g01980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4 Sigma70_r3 Sigma70_r4_2 HTH_23 Phage_terminase
Motif
Other DBs
NCBI-ProteinID: ACR27399
UniProt: C5A8X0
Position
1:208177..208902
Genome map
AA seq 241 aa AA seqDB search
MGEGGMGQAEVLAKYAPLVRRLGLQLVAKMPASVDLDDLIQAGMIGLLDAASRYKEDQGA
QFETYATQRIRGAMLDELRSNDWLPRSLRKTSREVEQAIHQVEQRLGRSANESEVATHLE
MPLDDYQAMLQDLHGSQLIYYEDFDRSADDEPFLDRYRVDHSDPLSALLDEHLRAALVEA
IDRLPEREKLLMSLYYERGLNLREIGAVLEVSESRVCQLHSQAVARLRARLREQAWVGAE
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagggcgggatggggcaggccgaggtgctcgcgaaatatgcgccgctggtgcgc
cggctcggcctgcagctggtcgcgaaaatgcctgcgagcgtcgatctcgacgacctgatc
caggccggcatgatcggcctgctcgatgcggcgagccgctacaaggaggatcagggcgcg
cagttcgagacctatgcgacgcagcgcatccgcggcgcgatgctcgacgagctgcgcagc
aacgattggctgccgcgcagcctgcgcaagacctcgcgcgaggtcgagcaggccattcat
caggtcgagcagcggctcgggcgctcggccaacgagagcgaggtcgccacccacctggag
atgccgctcgacgattaccaggcgatgctgcaggacctgcacggcagccagctgatctac
tacgaggatttcgaccgttcggccgacgacgagccgttcctcgaccgctaccgcgtcgac
cactccgacccgctgtccgcgctgctcgacgagcatctgcgcgcggcgctggtggaggcg
atcgaccgcctgcccgagcgcgagaagctgctgatgtcgctctactacgagcgcggcctg
aacctgcgcgagatcggcgccgtgctcgaggtcagcgagtcgcgcgtgtgccagctccac
agccaggccgtggcgcgcctgcgcgcgcggctgcgcgagcaggcctgggtgggagccgaa
cactga

DBGET integrated database retrieval system