KEGG   Burkholderia glumae BGR1: bglu_1g02000Help
Entry
bglu_1g02000      CDS       T00905                                 

Definition
(GenBank) hypothetical protein
  KO
K08972  putative membrane protein
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    bglu_1g02000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_4_2
Motif
Other DBs
NCBI-ProteinID: ACR27401
UniProt: C5A8X2
Position
1:210782..211135
Genome map
AA seq 117 aa AA seqDB search
MSLILTWIINALALLIITYLVPSIHIRSFGTALIVAVVLGLINAVIRPVLILLTLPVTIL
TLGLFILVVNALCFWLASSLLKGFEVSGFWSAFFGSILYSIVSWLLSALIFGQRSIG
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatcctgacctggatcatcaatgccctcgcgctgctcatcatcacctacctg
gtgccgtcgatccacatccgcagcttcgggacggcgctgatcgtcgcggtcgtgctcggg
ctgatcaacgcggtgatccggccggtgctgatcctgctgacgctgcccgtgacgatcctc
acgcttggcctgttcatcctcgtcgtcaacgcgctctgcttctggctggcgtcgtcgctg
ctgaagggcttcgaggtgtccggcttctggtcggcgttcttcggctcgatcctgtacagc
atcgtgtcgtggctcctgtccgccctgatcttcggccagcgcagcatcggctga

DBGET integrated database retrieval system