KEGG   Burkholderia glumae BGR1: bglu_1g02020Help
Entry
bglu_1g02020      CDS       T00905                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00330  Arginine and proline metabolism
bgl00360  Phenylalanine metabolism
bgl00380  Tryptophan metabolism
bgl00627  Aminobenzoate degradation
bgl00643  Styrene degradation
bgl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    bglu_1g02020
   00360 Phenylalanine metabolism
    bglu_1g02020
   00380 Tryptophan metabolism
    bglu_1g02020
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    bglu_1g02020
   00643 Styrene degradation
    bglu_1g02020
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     bglu_1g02020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Acetyltransf_6
Motif
Other DBs
NCBI-ProteinID: ACR27403
UniProt: C5A8X4
Position
1:complement(212133..213587)
Genome map
AA seq 484 aa AA seqDB search
MQDDYPNYDATDLAALIATRRASAREVLDAAIARANALNPSINAIVLTDYDAARERAAAP
PAGPLGGVPYLVKDLAAAAGLRMSLGSRHYRYFVPDADAPFIARAKAAGANVFGKTSTAE
FGQMPVTEPELFGPCRNPWNLDHTPGGSSGGAAAAVAAGIVPLAHASDGGGSIRIPASCC
GLFGFKPGYDPQLAAQPVPGDLIVNHAISRSVRDSALLFDLTTGRAGTSEATLARLDEPV
GALRIGLVTDPLFAAALSPDVLAALDDAARLAESLGHVVEPMRLPIDQARAAETFLTCWA
AIVEPLVHDAQALTGRRPRGDEFEPASRAMAQVGRHLARERLPLARDWQKQLIAQVESAT
ARYDLVLCATLAAPPVRIGELRSTPFERAQMRLLAALPARPLLRMMLANTAKRAFAWAGC
TELFNLTGQPAMSVPLHWNARGLPVGVQFAARRGDDARLLRFARQLELARPWFARRPPLV
PAAR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggacgattacccgaactacgatgccactgacctcgccgcgctgatcgccacccgg
cgggccagcgcgcgcgaggtgctcgacgccgcgatcgcgcgcgccaacgcactgaatccg
tcgatcaacgcgatcgtgctgaccgactacgacgcggcccgcgagcgggccgccgcgccg
ccggccggcccgctcggcggcgtgccctatctcgtcaaggatctcgcggcggcagccggg
ctgaggatgtcgctcggcagccgccactaccgctacttcgtgcccgacgccgacgcgccg
ttcatcgcgcgtgcgaaggcggccggcgccaatgtgttcggcaagaccagcaccgccgaa
ttcggccagatgccggtgaccgagcccgagctgttcgggccgtgccgcaacccctggaat
ctcgatcacacgccgggcggctcgagcggcggcgcggcggcggccgtggcggccggcatc
gtgccgctcgcgcatgcgtccgacggcggcggctcgatccgcatccccgcctcgtgctgc
ggcctgttcggcttcaagcccggctacgatccgcaactggcggcgcagcccgtgccgggc
gacctgatcgtcaaccatgcgatctcgcgcagcgtgcgcgacagcgcgctgctgttcgac
ctcaccacggggcgcgccggcacctccgaggccacgctcgcgcggctcgacgaaccggtg
ggggcgctgcgcatcggcctcgtcaccgatccgctgttcgcggcggcgctgtcgcccgac
gtgctggcggcgctcgacgacgcggctaggctagccgaatcgctcggccacgtggtggag
ccgatgaggctgccgatcgaccaggcgcgcgcggccgagaccttcctcacctgctgggcc
gccatcgtcgagccgctggtccacgacgcgcaggcgctcacggggcgccggccgcgcggc
gacgagttcgagccggcgagccgcgcgatggcgcaggtcgggcggcatctcgcgcgcgag
cgtctgccgctcgcgcgcgactggcaaaaacagctgatcgcgcaggtggagagcgccacc
gcacgctacgacctggtgctgtgcgcgacgctggcggcaccgcccgtgcggatcggcgag
ctgcgctccacgccgttcgagcgcgcgcaaatgcgcctgctcgccgccctgccggcgcgg
ccgctgctgcgcatgatgctcgcgaacacggccaagcgcgcgttcgcctgggccggctgc
accgagctgttcaacctcaccggccagccggcgatgtcggtgccgctgcactggaacgca
cgcggcctgccggtcggcgtgcagttcgccgcgcgccgcggcgacgacgcgcggctgctg
cgattcgcgcgccagctcgaactcgcgcggccgtggttcgcgcggcgtccgccgctggtg
ccggcggcgcgctaa

DBGET integrated database retrieval system