KEGG   Burkholderia glumae BGR1: bglu_1g02030Help
Entry
bglu_1g02030      CDS       T00905                                 

Definition
(GenBank) Putative dienelactone hydrolase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00361  Chlorocyclohexane and chlorobenzene degradation
bgl00364  Fluorobenzoate degradation
bgl00623  Toluene degradation
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    bglu_1g02030
   00361 Chlorocyclohexane and chlorobenzene degradation
    bglu_1g02030
   00623 Toluene degradation
    bglu_1g02030
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     bglu_1g02030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DLH BAAT_C AXE1 Abhydrolase_6
Motif
Other DBs
NCBI-ProteinID: ACR27404
UniProt: C5A8X5
Position
1:complement(213697..214392)
Genome map
AA seq 231 aa AA seqDB search
MTSQWIDIPVGNETFGGYLALPKGGKGPAVVIIQEIFGVNGHIRSVAEQYAADGYVALAP
DIFWRTQPRVELGYEGADFNKGLELLQKTDPHQAAADIGHAVAALRARPEVEGKRVAGIG
YCFGGRLAYLAAAAGALDVAVAYYGGGIQNHLDVANHVTQPIQFHYAGLDDHIPAEAVEQ
VRAAFGGRAHAQVHWYPDAGHGFNCNVRASYNQRAAALAHGRTLTFLAEQL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgcaatggatcgacatcccggtcggcaatgaaacgttcggtggctaccttgcc
ctgcccaagggcggcaagggaccggccgtggtgatcattcaggaaatcttcggcgtgaac
ggccacatccgttcggtcgccgagcaatatgcggccgacggctacgtcgcgctcgccccg
gacatcttctggcgcacccagccgcgcgtggagctcggttacgaaggcgccgacttcaac
aagggcctggagctgctgcagaagaccgatccgcaccaggccgcggccgacatcggccac
gcggtcgccgcgctgcgcgcgcgccccgaggtggaaggcaagcgtgtggccgggatcggc
tactgcttcggcggccggctcgcctacctggccgcggcggccggcgcgctcgacgtggcg
gtcgcctactatggcggcggcatccagaaccatctcgacgtcgcgaaccacgtcacgcag
ccgatccagttccactacgccggcctcgacgaccacatcccggccgaggcggtcgagcag
gtcagggccgcgttcggcggccgcgcgcacgcgcaggtgcactggtatccggatgccggc
cacggcttcaactgcaacgtgcgcgcctcctacaaccagcgcgcggcggcgctcgcgcac
ggccgcacgctgaccttcctcgccgagcagctgtaa

DBGET integrated database retrieval system