KEGG   Burkholderia glumae BGR1: bglu_1g02060Help
Entry
bglu_1g02060      CDS       T00905                                 

Definition
(GenBank) pyridoxamine 5'-phosphate oxidase family protein
  KO
K07226  heme iron utilization protein
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    bglu_1g02060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Putative_PNPOx Pyrid_oxidase_2
Motif
Other DBs
NCBI-ProteinID: ACR27407
UniProt: C5A8X8
Position
1:217764..218438
Genome map
AA seq 224 aa AA seqDB search
MKLSVSLPIHLLHRGQTGTLATHAREPAGFPYPTIVPYATDARHRPVVLVSALAEHTRNL
AADPRAGFLVADPEPAVVPAASAVLEAERVTLVGRFVRSDDDPHLAARYQRYHRDAARYL
GLGDFAFWVLECERLRFIGGFGRMGWLDGAELDALPPLSFDQEQALWARYPADERARELI
GVDRHGADWRIDGRLRRTAFANPATDFHALIDAVEIAATTIDSP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctgtccgtctcgctaccgatccacctgctgcatcgcgggcagaccggcacgctt
gcgacccatgcgcgcgagccggccggcttcccgtatccgaccatcgtgccctacgccacc
gatgcgcggcatcggccggtggtgctggtcagcgcgctggccgagcacacccgcaatctg
gccgccgacccgcgcgccggctttctggtggccgacccggaaccggccgtcgtgcccgcc
gcgagcgcggtgctcgaggccgaacgtgtcacgctcgtcggccgtttcgtgcgaagcgac
gacgatccgcatctcgccgcgcgttatcagcgatatcaccgcgatgcggcgcgctatctc
gggctcggtgatttcgcgttctgggtgctcgaatgcgagcggctgcgcttcatcggcggc
ttcggtcgaatgggctggctcgacggcgccgaactggacgcactgccgccgctctcgttc
gaccaggagcaggcattatgggcgcggtacccggctgatgagcgcgcgcgggaattgatc
ggcgtcgaccggcatggcgccgattggcggattgacggacggctgcgacgtaccgctttt
gccaatccggcgaccgatttccacgcactcatcgacgccgtcgagatcgcggcgaccact
attgattcgccgtga

DBGET integrated database retrieval system