KEGG   Burkholderia glumae BGR1: bglu_1g02230Help
Entry
bglu_1g02230      CDS       T00905                                 

Definition
(GenBank) Lysine exporter protein LYSE/YGGA
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysE TerC SdpI DUF2648
Motif
Other DBs
NCBI-ProteinID: ACR27424
UniProt: C5A8Z5
Position
1:233112..233747
Genome map
AA seq 211 aa AA seqDB search
MSLHTWSLFLATMFVVSAIPGPNMLLVMSHGARYGMRRSAATMAGALLALVLMFLISAAG
LGVFLAAWPRMFDALRLAGAAYLIWLGVKAWRARVEQAPAVDGAAAVPAGFATPGALFRN
GFLVSGSNPKALLFAAALTPQFIDPNAPKLPQFASLVVTLAVCEVSWYLVYCGFGTRIGA
TLKSARVVRIFNRLTGGVFVGFGAAMALVRH
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcatacgtggagcctgttcctggcgacgatgttcgtggtgtcggcgataccg
gggccgaacatgttgctggtgatgtcgcacggggcccgctacgggatgcgccgttcggcg
gccaccatggccggcgcgctgctcgcgctggtgctgatgttcctgatctcggcggccggg
ctcggcgtgttcctggccgcgtggccgcgcatgttcgatgcgctgcggctggccggcgcc
gcctatctgatctggctcggcgtgaaggcgtggcgcgcgcgcgtcgagcaggcgccggcc
gtcgacggggccgccgcggtgccggccgggttcgcgacgccgggcgcgctgttccgcaac
ggcttcctggtgtcgggcagcaacccgaaggcgctgctgttcgcggcggcgctcacgccg
cagttcatcgatccgaacgcgccgaagctgccgcagttcgcgtcgctggtcgtgacgctg
gccgtctgcgaggtgagctggtatctggtctattgcgggttcggcacgcggatcggcgcg
acgctcaagagcgcgcgcgtggtgcggatcttcaaccgcctgacgggcggcgtgttcgtc
ggtttcggcgcggcgatggcgctggtgcgccactga

DBGET integrated database retrieval system