KEGG   Burkholderia glumae BGR1: bglu_1g02240Help
Entry
bglu_1g02240      CDS       T00905                                 

Definition
(GenBank) OmpW family outer membrane protein
  KO
K07275  outer membrane protein
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    bglu_1g02240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpW OMP_b-brl OprF
Motif
Other DBs
NCBI-ProteinID: ACR27425
UniProt: C5A8Z6
Position
1:complement(233976..234812)
Genome map
AA seq 278 aa AA seqDB search
MNKTLLRGAAVLAAALGASGAQAQSAGSNVIGLGWFHITPIQSSTSLVTNVAPTPINTPL
SLPPSFDSPGTGLRTNNSDTLGLTISHFFTDNVAVTSVAGVPPVFQVSGHGTIVPPGPAG
ALGTQNIGLDAVNPIVKSVRQWSPAVILQYYFANANSKLRPFVGIGVSYNWFSDLQLSNN
FIKQTQDNLGSILAAGAGKPGTTQVSAKASSSWQPVFNAGLTYSINQHWGLIASVTYIPL
KTTSTVTIKAADGTTLAESKGDLKANPIISYLAVSYKF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaagacccttcttcgcggcgcagccgtgctcgccgccgcgctcggcgccagcggc
gcgcaggcgcaaagcgccggcagcaacgttatcggcctcggctggttccatatcacgccg
atccagagcagcacgtcgctggtcaccaacgtggccccgacgccgatcaacacgccgctg
agcctgccgccctcgttcgactcgccgggcaccgggttgcgcaccaacaactcggacacg
ctcggcctgacgatcagccacttcttcaccgataacgtcgccgtcacctcggtggcgggc
gtgccgccggtgttccaggtatcggggcacggcacgatcgtgccgcccgggccggccggc
gcgctcggcacgcagaacatcgggctcgacgcggtcaacccgatcgtcaagagcgtgcgc
cagtggagcccggccgtgatcctgcagtactacttcgcgaacgccaattcgaagctgcgg
ccgttcgtcggcatcggcgtgtcgtacaactggttcagcgacctgcagctcagcaacaac
ttcatcaagcagacgcaggacaacctcggttcgatcctcgcggccggcgccggcaagccc
ggcaccacgcaggtgtcggcgaaggcgtcgtcgtcgtggcagccggtgttcaacgcgggt
ctgacctactcgatcaaccagcactgggggctgattgcctcggtaacctacatcccgctg
aagaccacctcgaccgtgacgatcaaggcggccgacggcacgacgctcgccgaatcgaag
ggcgacctgaaggcaaacccgatcatcagctacctcgcggtgtcgtacaaattctga

DBGET integrated database retrieval system