KEGG   Burkholderia glumae BGR1: bglu_1g03930Help
Entry
bglu_1g03930      CDS       T00905                                 

Definition
(GenBank) putative type VI secretion system protein TssF
  KO
K11896  type VI secretion system protein ImpG
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgl02044]
    bglu_1g03930
Secretion system [BR:bgl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bglu_1g03930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF SOR_SNZ
Motif
Other DBs
NCBI-ProteinID: ACR27592
UniProt: C5AA69
Position
1:404540..406378
Genome map
AA seq 612 aa AA seqDB search
MEELLPYYERELSFLRRYSHEFARRYPKIAARLAMTGEHCDDPHVERMIESFALLGARIN
KKLDDDYPEFTEALVDVLYPHYLRPFPSCTIAQFTPTPAISQLTAPHRVARGTELKSRAI
RGVQCQFRTAYDVTIAPIRISEARYSSIAVAPAATVLPGNATGVISITFESLAPQFDLGA
LGLDTLRAHLHGEQSFVAALADCLFINTLATYVEPERNGRWTALRRSPVTQAGFGEEDAL
IDYPARSHPAYRLLTEYFAFPDKFDFVDFDLAAMARRAGPCHRLTLHVVLSDVRSDSHVA
RLLDMLSATHLRLFCTPVVNLFKQNGEPIRVDHQSVSYPVIAEARRAFAYEVYSIDSVHL
VRQTAHEEAVVEFRPFYSLHHGEAGHVGHYWFARRNEWVAQHSPGYETELSIVDIDFEPA
APQTDTLSLRLTCTNRDLPAGLATGLAGGDLFADGGADFGDITMLRRPTASVRFARGRAA
HWRLISHLALNHVSLVADGLAPLKELLTLYDLRRSAVSMRHIDGLVAIEQRGSVQWLPGK
PFATFVRGIEIRLTIDEEHFVGTSLAAFARMLDVFFGLYVHLNSFVQLIVVSKRTGEEIM
RCQPRSGESILA
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggaagagctgctgccgtactacgagcgcgaactgtcgtttctgcggcgctactcgcac
gaattcgcgcggcgctatccgaagatcgcggcacggctcgcgatgacgggcgagcattgc
gacgacccgcacgtcgagcgcatgatcgaatcgttcgcgctgctgggcgcgcgcatcaac
aagaagctcgacgacgactatccggaattcaccgaggcgctcgtcgatgtgctctatccg
cactacctgcggccgttcccgtcctgcaccatcgcgcagttcacgcccaccccggcgatc
tcgcagttgaccgcgccgcatcgcgtggcgcgcggcaccgagctgaagagccgcgcgatc
cgcggcgtgcagtgccagttccgcaccgcctatgacgtgacgatcgcgccgatccgcatc
agcgaggcgcgctattcgtcgatcgccgtcgcgccggccgccaccgtgctgcccggcaac
gccaccggcgtgatctcgatcaccttcgagtcgctcgcgccgcagttcgacctcggcgcg
ctggggctcgacacgctgcgcgcgcacctgcacggcgagcagtcgttcgtggccgcgctg
gccgactgcctgttcatcaacacgctggccacctacgtcgagcccgagcgcaacggccgc
tggacggcattgcgccgttcgcccgtgacgcaggccggcttcggcgaagaggacgcgctg
atcgactacccggcgcgctcgcatccggcctaccggctgctgaccgaatacttcgcgttt
cccgacaagttcgatttcgtcgatttcgacctggccgcgatggcgcgccgcgcggggccg
tgccaccgcctgacgctgcacgtcgtgctcagcgacgtgcgcagcgattcgcacgtggcg
cgcctgctcgacatgctgagcgccacccacctgcgcctgttctgcacgccggtggtgaac
ctgttcaagcagaacggcgagccgatccgcgtcgatcaccagagcgtgtcgtacccggtg
atcgccgaggcgcgccgcgcgttcgcctacgaggtctattcgatcgactcggtgcatctg
gtgcgccagaccgcgcacgaggaggcggtggtggagttccggccgttctactcgctgcat
cacggcgaggccggccatgtcggccactactggttcgcgcgccgcaacgagtgggtcgcg
cagcacagccccggctacgagaccgagctgtcgatcgtcgacatcgatttcgagccggcc
gcgccgcagaccgacacgctgagcctgcgcctgacctgcaccaaccgcgatctgccggcg
gggctcgccaccggcctggccggcggcgacctgttcgccgacggcggcgccgatttcggc
gacatcacgatgctgcgccggcccacggcgagcgtgcgcttcgcgcgcgggcgcgccgcg
cactggcggctgatctcgcatctcgcgctgaaccacgtctcgctggtggccgacggcctc
gcgccgctcaaggaactgctcacgctctacgatctgcgccgctcggcggtctcgatgcgc
cacatcgacgggctggtcgcgatcgagcagcgcggctccgtgcagtggctgcccggcaag
ccgttcgcgaccttcgtgcgcggcatcgagattcgcctgacgatcgacgaggaacacttc
gtcggcaccagcctcgccgcattcgcgcgcatgctcgacgtgttcttcgggctgtacgtc
cacctcaacagctttgtgcaactgatcgtcgtgtccaagcgcaccggcgaggagatcatg
cgatgccaaccgcgaagcggcgaatcgatcctggcgtag

DBGET integrated database retrieval system