KEGG   Burkholderia glumae BGR1: bglu_1g04430Help
Entry
bglu_1g04430      CDS       T00905                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    bglu_1g04430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: ACR27641
UniProt: C5AAB9
Position
1:461714..462088
Genome map
AA seq 124 aa AA seqDB search
MSQYEFSVSVKTAYLPEQSDPERRQYAFAYTLTIRNTGQVAAQLIARHWVITDSEQQVQE
VKGLGVVGHQPLLKPGEQFEYTSWAVIATPVGSMRGAYFCVAEDGERFDAPVAEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtacgaattcagcgtgtcggtgaaaacagcttatctgccggaacaatccgac
ccggagcggcgtcaatatgcattcgcctacacgctgacgattcgcaataccggccaggtg
gcggcgcagctgatcgcgcggcactgggtgatcaccgacagcgaacagcaggtgcaggaa
gtgaagggactcggcgtggtcggccatcagccgctcctgaagccgggcgagcaatttgaa
tacacgagctgggcggtgatcgcgacgccggtgggcagcatgcgcggcgcttacttctgc
gtggccgaggacggcgagcgcttcgacgcgccggtcgccgaattcgcgctgcacatgccg
cgcacgctgcactga

DBGET integrated database retrieval system