KEGG   Burkholderia glumae BGR1: bglu_1g05220Help
Entry
bglu_1g05220      CDS       T00905                                 

Definition
(GenBank) L-arabinose transporter permease
  KO
K10538  L-arabinose transport system permease protein
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    bglu_1g05220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgl02000]
    bglu_1g05220
Transporters [BR:bgl02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   L-Arabinose transporter
    bglu_1g05220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ACR27718
UniProt: C5AAX5
Position
1:550454..551470
Genome map
AA seq 338 aa AA seqDB search
MQAKESITQAAAKRTAEALIPQTSDRQKWWQQITDYSLIVIFAVMFITMSVTVDHFFSID
NMLGLALSISQIGMVACTMMFCLASRDFDLSIGSTVAFSGVLCAMVLNATDNTFVAIVAA
IAAGAAIGFVNGAVIAYLRINALITTLATMEIVRGLGFIVSHGQAVGVSSETFIALGGLT
LFGVSLPIWVTLLCFIVFGVLLNQTVYGRNTLAIGGNPEASRLAGINVERTRVWIFLIQG
AVTALAGVILASRITSGQPNAAEGFELNVISACVLGGVSLLGGRATISGVVIGVLIMGTV
ENVMNLLNIDAFYQYLVRGAILLAAVLLDQLKNRGARD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccaaggaaagtatcacgcaggcagccgccaaacgcacggccgaagccttgatt
ccgcagaccagcgaccggcagaagtggtggcagcagatcaccgactacagcctgatcgtg
atcttcgcggtgatgttcatcaccatgtcggtgacggtcgatcacttcttctcgatcgac
aacatgctcgggctcgcgctgtcgatctcgcagatcggcatggtcgcctgcaccatgatg
ttctgtctcgcctcgcgcgacttcgacctgtcgatcggctcgacggtggcgttctcgggc
gtgctctgcgcgatggtgctcaacgccaccgacaacaccttcgtggcgatcgtcgcggca
atcgcggcgggtgccgcgatcggtttcgtcaacggcgcggtgatcgcctacctgcgcatc
aacgcgctgatcaccacgctcgccaccatggagatcgtgcgcgggctcggcttcatcgtc
tcgcacggccaggcggtgggcgtctcgtcggagaccttcatcgcgctgggcggcctcacg
ctgttcggcgtatcgctgccgatctgggtcacgctgctctgcttcatcgtgttcggcgtg
ctgctgaaccagaccgtctacggccgcaacacgctggcgatcggcggcaatccggaagcc
tcgcgcctggccggcatcaacgtcgagcgcacgcgcgtctggatcttcctgatccagggc
gccgtgacggcgctggcgggcgtgatcctcgcctcgcggatcacctcgggccagccgaac
gcggccgagggcttcgagctcaacgtgatctcggcctgcgtgctcggcggcgtgtcgctg
ctgggcgggcgcgcaaccatctcgggcgtggtgatcggcgtgctgatcatgggcacggtc
gagaacgtgatgaacctgctcaacatcgacgcgttctaccagtacctggtgcgcggcgcg
atcctgctcgccgcggtgctgctcgatcagttgaagaaccgcggcgcgcgcgactga

DBGET integrated database retrieval system