KEGG   Burkholderia glumae BGR1: bglu_1g10360Help
Entry
bglu_1g10360      CDS       T00905                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    bglu_1g10360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bgl03400]
    bglu_1g10360
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     bglu_1g10360
DNA repair and recombination proteins [BR:bgl03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     bglu_1g10360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD SH3_13 UvrD-helicase DUF2075 MukB Flavi_DEAD CbiA UvrD_C DEAD
Motif
Other DBs
NCBI-ProteinID: ACR28208
UniProt: C5ADG3
Position
1:1127462..1129783
Genome map
AA seq 773 aa AA seqDB search
MKDLTEPFGFVGGLAERLPEPADFGLALAEGFARRIGMLSRRLGAPADAARWAARAAFAA
SRATAAGHVCIALGALAARYAVSLDQVRAELAASGVTAFGRAPRGADCPLVVDAQGRLYL
ARYFDYETRLADALVAHARAARPEADGALAPARLRESLARYFAPPREGEIDWQRVAAVVA
LGGRLTIVSGGPGTGKTTTVVGVIACLIELQPALRIALAAPTGKAAQRMQEALHARAAGL
PAEFAAQLPRTSYTLHRLLGWLPGGRFRHHRDNPLPYDLVVVDEASMIDVALAAHLLDAL
APGARLVLLGDKDQLAAVEAGAVFAELSARPAFSAAGCERIAAALGVSPAAFVAALPDEA
RATAPAGATQGANRAGADGRPASAAAPRRRGARPAPPEAGGMPVQRSLFDFDEVAASTDA
SACAAESASRAGQAGFADAPLEAWIEPDELAWLDAWRIDEVQAARFDAGRTGMPAVPGPG
REPASHADAPAVGEPLADCVVWLERNYRFGLDSPIGRLSLAIRRGDAQAALDALSTQADA
AARFIDDGGDALAAATIERLADGFAAYGRALREVLAGGEPDPLPLFDVLNRFRVLCATRT
GARGADEINLRVAALVRRAVGVPLAVGAHWFAGRPVMVTRNDYALGLFNGDIGIALHDAQ
GALRVWFRGADGLARAVSPAALPPHDTAFALTVHKSQGSEFDEAALVLPAAFGRVLSREL
VYTAITRARSRVQVIGPRAVLAQAIATRTQRDSGLAARIADAAQAAAEAEARH
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatctgaccgaaccgttcggcttcgtcggcggcctcgccgagcgcctgcccgag
cctgccgatttcgggctcgcgctcgccgagggcttcgcgcgccgcatcgggatgctgtcg
cgccggctcggcgcgcccgccgatgcggcgcgctgggccgcgcgcgcggcgttcgcggcg
agccgcgccaccgcggcggggcatgtctgcatcgcgctcggtgcgctcgccgcgcgctac
gccgtgtcgctcgaccaggtgcgcgccgagctggccgcgagcggtgtgaccgcgttcggc
cgcgcgccgcgcggcgccgactgtccgttggtggtggacgcgcaggggcggctctacctc
gcccgctatttcgactacgagacgcggctcgccgacgcgctggtcgcgcacgcccgcgcg
gcgcgtcccgaggcggacggcgcgctggcgccggcgcgcctgcgcgagagcctcgcgcgc
tacttcgcgccgccgcgcgagggcgagatcgactggcagcgcgtggcggccgtggtcgcg
ctcggcggccgcttgacgatcgtcagcggcgggccgggcaccggcaagaccaccaccgtg
gtcggcgtgatcgcctgcctgatcgagctgcagccggcgctgcgcatcgcgctcgcggcg
ccgaccggcaaggccgcgcagcgcatgcaggaggcgctgcacgcgcgcgcggccgggctg
cccgccgagttcgccgcgcaactgccgcgcacctcgtacacgctgcaccggctgctcggc
tggctgcccggcggccggttccgccaccaccgcgacaacccgctgccctacgatctcgtc
gtggtcgacgaggcatcgatgatcgacgtcgcgctggcggcccacctgctcgatgcgctc
gcgcccggcgcgcggctcgtgctgctcggcgacaaggaccagctcgccgccgtggaggcg
ggcgcggtgttcgccgaactgagcgcacggccggcattcagcgcggccggctgcgagcgg
atcgccgcggcgctcggcgtgagcccggcggccttcgtcgccgcgctgcccgacgaggca
cgcgcgacggcgccggccggcgcaacgcagggcgcgaaccgggccggtgccgacggccgg
ccggcctcggccgccgcgccgcggcggcgcggggcacgcccggcgccgcccgaggctggc
ggcatgccggtgcagcgctcgctgttcgatttcgacgaggtcgccgcgagcaccgatgcg
tccgcttgcgcagccgaatcggcgagccgggccggccaggcaggcttcgccgacgcgccg
ctcgaggcgtggatcgaacccgacgagctggcgtggctcgatgcatggcgcatcgacgag
gtccaggcggcgcggttcgacgcggggcgcaccggcatgcccgcggtgccggggcccggg
cgcgagccggcaagccacgccgatgcgcccgccgtgggcgagccgctcgccgactgcgtg
gtctggctcgaacgcaactaccgcttcggcctcgattcgccgatcggccggctgtcgctg
gcgatccggcgcggcgacgcgcaggccgcgctcgacgcgctatcgacgcaggccgacgcc
gccgcgcggttcatcgacgacggcggcgacgcgctggccgccgccaccatcgagcgcctt
gccgacggcttcgccgcctatggccgggccctgcgcgaggtgctcgccggcggcgagccg
gacccgctgccgctgttcgacgtgctgaaccgcttccgggtgctctgcgcgacgcgcacc
ggcgcgcgcggggccgacgagatcaatctgcgcgtggcggcgctggtgcggcgcgcggtg
ggcgtgccgcttgccgtgggcgcgcactggttcgccggccggccggtgatggtcacgcgc
aacgactacgcgctcggcctgttcaatggcgatatcggtatcgcgctgcacgacgcgcag
ggggcgctgcgggtctggttccggggcgccgacgggctcgcgcgcgccgtctcgccggcc
gcgctgccgccgcacgatacggccttcgcgctgaccgtccacaagtcgcagggctcggaa
ttcgacgaggccgcgctggtgctgccggccgcgttcggccgcgtgctgtcgcgcgaactg
gtctacaccgccatcacgcgggcccgctcgcgcgtgcaagtgatcggcccgcgcgccgtg
ctcgcgcaggcgatcgcgacccgcacgcaacgcgattcgggcctcgccgcgcgcatcgcc
gatgccgcgcaggcggccgccgaggccgaggcacggcactag

DBGET integrated database retrieval system