KEGG   Burkholderia glumae BGR1: bglu_1g11570Help
Entry
bglu_1g11570      CDS       T00905                                 

Definition
(GenBank) DJ-1/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    bglu_1g11570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bgl01002]
    bglu_1g11570
Enzymes [BR:bgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     bglu_1g11570
Peptidases [BR:bgl01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   bglu_1g11570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ACR28326
UniProt: C5AE66
Position
1:complement(1271679..1272377)
Genome map
AA seq 232 aa AA seqDB search
MPCRIALLMFPGVQALDLVGPHDVFAALPDTTLHRVAKSTAPLAAAHGLVMTPDTDFDAC
PDVDVLCVPGGSGVDELLLDDATLAFVRRAAASARYLGSVCTGALVLGAAGLLRGRRATT
HWASLPLLAAFGAMPVQERVVRDGRLVTGGGVTAGIDFALTIARELHGEAVAQAAQLAIE
YAPAPPFGAGCPATAPCAVVDAERARYAPIIAAREARVAQAAARLAADHPAR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtcgaatcgcactcctgatgtttcccggcgtccaggccctcgacctcgtcggc
ccgcacgacgtattcgcggcactgcccgacaccacgctccaccgcgtcgcgaaaagcacc
gcgccgctcgccgccgcccacggcctggtgatgacgcccgacaccgatttcgacgcctgc
cccgacgtcgacgtgctgtgcgtgccaggcggctccggcgtcgacgaactgctgctcgac
gacgcgacgctcgcgttcgtgcggcgagcggccgcctcggcgcgctacctcggttcggtc
tgcaccggcgcgctggtactcggcgccgcaggcctgctgcgtggccgccgcgcgaccacc
cattgggcctcgctgccgctgctcgcggcgttcggcgccatgccggtgcaggagcgcgtg
gtgcgcgacggacggctcgtcacgggcggcggggtcacggccggcatcgacttcgcgctg
accatcgcccgcgagctgcacggcgaggccgtcgcgcaggccgcgcagctggcgatcgaa
tacgcgcccgcgccaccgttcggtgcgggctgccccgcgacggcgccgtgcgcagtggtc
gatgccgagcgggcccgctacgcgccgatcatcgcggcacgcgaggcacgggtcgcgcag
gcggccgcgcggctcgcggccgaccatccggcgcgctga

DBGET integrated database retrieval system