KEGG   Burkholderia glumae BGR1: bglu_1g25960Help
Entry
bglu_1g25960      CDS       T00905                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00010  Glycolysis / Gluconeogenesis
bgl00051  Fructose and mannose metabolism
bgl00562  Inositol phosphate metabolism
bgl00710  Carbon fixation in photosynthetic organisms
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
bgl01200  Carbon metabolism
bgl01230  Biosynthesis of amino acids
Module
bgl_M00002  Glycolysis, core module involving three-carbon compounds
bgl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bglu_1g25960
   00051 Fructose and mannose metabolism
    bglu_1g25960
   00562 Inositol phosphate metabolism
    bglu_1g25960
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    bglu_1g25960
Enzymes [BR:bgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     bglu_1g25960
Exosome [BR:bgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   bglu_1g25960
  Exosomal proteins of bladder cancer cells
   bglu_1g25960
  Exosomal proteins of melanoma cells
   bglu_1g25960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACR29672
UniProt: C5AAL2
Position
1:complement(2958154..2958909)
Genome map
AA seq 251 aa AA seqDB search
MSTQRVKRVIGNWKMHGRLNGNRALLGEVLDGAQAVSADVEIGVCVPFPYLAQVGELLAG
SRVASGAQDVSAHEQGAYTGEVAGAMIAEFGAKYVLVGHSERRTYHGESSNLVAVKAQRA
LGAGLTPVVCVGETLAEREAGSTETVVGAQLDAALALLSDQEAARIVVAYEPVWAIGTGK
SASSEQAQQVHAFLRSRLAAKGVEQVSVLYGGSVKPDNARELFGQPDIDGGLIGGASLKG
GDFLAICRAAQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacaacgagtgaagcgggtaatcggtaactggaagatgcacggccgtctcaac
ggcaatcgcgcgctgctgggcgaagtgctcgatggggcgcaggccgtgtcggccgacgtc
gagatcggcgtatgcgtgccgtttccgtatctggcgcaggtcggcgaattgcttgccggc
agccgtgtcgcgagcggcgctcaggacgtgtcggcgcacgagcaaggcgcgtacacgggc
gaggtggccggcgcgatgatcgccgagttcggcgcgaaatacgtgctggtcggccactcc
gagcgccgtacctatcacggcgaatcgagcaatctggtcgccgtgaaggcgcagcgcgcg
ctcggcgcggggctgaccccggtggtctgcgtcggcgagacgctggccgagcgcgaagcg
ggttcgaccgagacggtggtcggcgcgcagctcgatgcggcgctcgcgctgctgtcggac
caagaggcggcgcgcatcgtggttgcctacgagccggtctgggcaatcggcacgggcaag
agcgcaagttcggagcaggcacagcaggtgcatgccttcctgcgttcgcggcttgcggcc
aagggcgtcgagcaggtttccgtgctgtacggcggcagcgtgaagccggacaatgcgcgc
gaactgttcggtcagcccgacatcgacggcggcctgatcggtggcgcatcgttgaagggc
ggcgatttcctggcgatctgccgcgcggcgcagtaa

DBGET integrated database retrieval system