KEGG   Burkholderia glumae BGR1: bglu_2g01470
Entry
bglu_2g01470      CDS       T00905                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    bglu_2g01470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgl02044]
    bglu_2g01470
Secretion system [BR:bgl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bglu_2g01470
SSDB
Motif
Pfam: DotU OmpA RFC1
Other DBs
NCBI-ProteinID: ACR30635
UniProt: C5ALD4
Position
2:161937..163253
AA seq 438 aa
MSTHAHDEAFSFLAEPGQGETVSGAGASGGAFGPPPAAMDSVAFEPPEDAATRLARVQAA
RNPLLEAARSLLRMLGDMPASLESSAAVESLRALLVREVAAFQKVCDKANLPWKHVAAVR
YALCTGLDEAANRTQWGGGGIWAARSLLIRFEGEVDGGEKFFLLIGRMATDPQEYVDVLE
VMYRILGLGFEGRYSVAEDGSRHLEEIRQRLLTLVSGARDTMRLEFSPHWRGEAYDQLKL
LRSVPVWATASVAALVVFGRFGWYTYHLLTVRNPLEARILAIGRSPAPAAHAAPAHLPLR
LSVLLKDEIARGELTVDEDARHSKVVFRGDTMFVTGKSRVRPELEPVLAKVAREVARVGG
RVIVTGYTDSQPIHTREFPDNLVLSQKRAAFVADVLKAHGTPSERIVSIGKGDAQPVADN
ATPQGRSRNRRVEVLVVQ
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgagcacgcatgctcatgacgaggccttcagtttcctcgcggagccggggcagggcgag
accgtgtccggcgcgggcgcgtcggggggcgctttcgggccgccccctgcggccatggac
agcgtcgcgttcgagccacccgaggacgcggccacgcgcctcgcgcgcgtacaagctgcg
cgcaatcccttgctcgaggcggcgcgctcgttgctgcgcatgctcggcgacatgccggcc
tcgctcgaatcgtcggcggccgtcgaaagcctgcgcgcgctgctggtgcgcgaggtcgcc
gcgtttcagaaggtctgcgacaaggcgaatttgccatggaagcacgtcgctgcggtgcgc
tacgcactgtgcaccggactcgacgaggcggccaatcgcacccagtggggcggcggcggc
atctgggccgcgcgcagcctgttgatccgtttcgagggcgaggtcgacggcggcgagaaa
ttcttcctgctgatcggtcggatggcgacagacccgcaggagtacgtcgacgtgctcgag
gtgatgtaccggattctcggcctcggcttcgaggggcgctatagcgtcgccgaggatggc
agccgccatctcgaggagatacgccagcggctgctcaccctcgtgagcggcgcgcgcgac
acgatgcgcttggaattctcgccacattggcgcggcgaggcgtatgaccagttgaaattg
ttgcgcagcgtccccgtgtgggccacggcgagcgtcgctgcgctcgtcgtgtttggtcgc
ttcggctggtacacctatcacttgttaacggtccgcaatccgctggaggcgcggatcctc
gcgatcggccgctcgcccgcgccggccgcacatgcagcgccggcgcatctgccgctacgg
ctgtcggtgctgctcaaggatgaaatcgcgcgtggcgagttgacggtcgacgaggacgcg
cggcacagcaaggtggtgttccggggcgacaccatgttcgtcaccggcaagagccgcgtc
cgacccgagctggagccggttctggcaaaggtggcgcgcgaggtcgcccgggtgggcggg
cgtgtgatcgtgaccggctataccgacagccagccgatccatacccgcgagtttcccgac
aatctggtcctgtcccagaagcgtgcggcgttcgtcgccgacgtgctgaaggcgcatggc
acgccctccgagcggattgtgtcgatcggcaagggcgacgcgcagccggtggccgacaat
gccacgccgcaggggcgctcgcgcaaccggcgcgtggaagtcctcgtggtgcaatga

DBGET integrated database retrieval system