KEGG   Burkholderia glumae BGR1: bglu_2g02120
Entry
bglu_2g02120      CDS       T00905                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgl02044]
    bglu_2g02120
Secretion system [BR:bgl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bglu_2g02120
SSDB
Motif
Pfam: T6SS_VipA AAA_31 SMG1 Xpo1
Other DBs
NCBI-ProteinID: ACR30684
UniProt: C5ALI3
Position
2:245401..245859
AA seq 152 aa
MHTGGARKKVELPLKLLVAGDFSAGREQAPLAERKKINIDKNNFDAVLADYAPDLKISAE
NTLAGDGSALPVNLSFRSMKDFEPEQVARQIPELQAMLAMRNLLRDLKSNLLDNGTFRRE
FEKILKDKHLSDKLRSELAQVATAATQPEGQA
NT seq 459 nt   +upstreamnt  +downstreamnt
ctgcatacgggcggagcccggaagaaggtcgagctgccgctcaagctgctcgtcgccggc
gacttcagcgcgggtcgggaacaggcgccgctggccgaacgcaagaagatcaatatcgac
aagaataatttcgatgccgtgcttgccgactatgcccccgacctgaagatctccgccgag
aacacgctcgcgggcgatggttcggcgttgccggtgaacctctcgttccggtcgatgaaa
gacttcgagccggagcaggtggcccggcagattccggaactgcaggcgatgctggcaatg
cgcaatctgctgcgggatctgaaaagcaacctgctcgacaacggcaccttcaggcgcgag
ttcgagaagatcctgaaggataagcatctgtctgacaagctgcgcagcgagctcgcgcag
gtcgccaccgcagccacccaaccggaaggtcaggcctga

DBGET integrated database retrieval system