KEGG   Burkholderia glumae BGR1: bglu_2g02760Help
Entry
bglu_2g02760      CDS       T00905                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00360  Phenylalanine metabolism
bgl00362  Benzoate degradation
bgl00620  Pyruvate metabolism
bgl00621  Dioxin degradation
bgl00622  Xylene degradation
bgl00650  Butanoate metabolism
bgl01100  Metabolic pathways
bgl01120  Microbial metabolism in diverse environments
bgl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bglu_2g02760
   00650 Butanoate metabolism
    bglu_2g02760
  Amino acid metabolism
   00360 Phenylalanine metabolism
    bglu_2g02760
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bglu_2g02760
   00622 Xylene degradation
    bglu_2g02760
   00621 Dioxin degradation
    bglu_2g02760
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     bglu_2g02760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh DapB_N Glu_dehyd_C GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ACR30741
UniProt: C5ALP0
Position
2:323239..324168
Genome map
AA seq 309 aa AA seqDB search
MKNRTTRAERQPRAAGTARTRVAILGSGSIGIDLMFKVKACEQFDLACVVGRNADSDGLR
LARECQVETSSDGLAFLRANAGAYDLVFDATSAAAHTEHNRFFAEAGKFAIDLTPAKVGR
LCVPCINLPDTHAVQNVNLITCGGQASLPLAYALRQAVDEIDYLEVVSAIASRSAGMATR
ENINEYQTTTEYALAKFSGAKRAKAILNINPAEPGIQMQTTLYAHARYRDFGRVRSRIQA
MVEQVREYVPGYQLVVEPLESQGRITVSLTVRGRGDYLPEYAGNLDIINCAALAVATHRH
ATLRSGVTQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccgaaccacccgtgccgagcgccagccgcgcgccgccggcaccgcgcgcacc
cgcgtcgccatcctcggctcgggcagcatcggcatcgacctgatgttcaaggtgaaggcc
tgcgagcagttcgatctcgcatgcgtggtcggacgcaacgcggacagcgacggcctgcgg
ctcgcgcgcgaatgccaggtggagacctcgagcgacgggctcgccttcctccgggccaac
gccggtgcctacgacctcgtcttcgacgccacctcggcggccgcgcacaccgagcacaac
cgctttttcgccgaggccggcaagttcgcgatcgacctgacgccggccaaggtcggccgg
ctctgcgtgccctgcatcaacctgcccgatacgcacgcggtgcagaacgtgaacctgatc
acctgcggcggccaggccagcctgccgctcgcctatgcgctgcgccaggccgtcgacgag
atcgactatctggaggtggtctcggcgatcgcctcgcgcagcgccggcatggccacgcgc
gagaacatcaacgagtatcagaccaccaccgagtacgcgctggcgaagttcagcggcgcg
aagcgcgccaaggcgatcctcaacatcaatccggccgagcccggcatccagatgcagacc
acgctgtatgcgcacgcgcgctaccgcgacttcggccgggtgcgctcgcgcatccaggcg
atggtcgagcaggtgcgcgagtacgtgcccggctaccagctggtggtggagccgctggag
agccaggggcgcatcaccgtgagcctgaccgtgcgcgggcgcggcgactacctgcccgag
tacgcgggcaacctcgacatcatcaactgcgcggcgctcgcggtggccacgcaccggcat
gcaacccttcgctcaggagtgacgcaatga

DBGET integrated database retrieval system