KEGG   Burkholderia glumae BGR1: bglu_2g03990Help
Entry
bglu_2g03990      CDS       T00905                                 

Definition
(GenBank) Phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    bglu_2g03990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TctB
Motif
Other DBs
NCBI-ProteinID: ACR30857
UniProt: C5AM06
Position
2:complement(476682..478262)
Genome map
AA seq 526 aa AA seqDB search
MNQSALPTADAGRSRRFGQLVFLAVLVVGGAYVLTHLMADLAPVGEPSVFPYVLLGIALL
IALGFEFVNGFHDTANAVATVIYTHSLAPNVAVVWSGLWNFAGVLLSSGAVAFGILQLLP
VELILQVGSGAGFAMVFALLIAAIVWNLTTWYFGLPSSSSHTLIGSIIGVGVMNQLMHGA
SGTSGVDWSQALGVGKSLLFSPIVGFVLSGLLLLLLKGLVKLPQLYREPPKDKTPPFWIR
CLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAFALNKAVTPAESQTFIAVAHQAA
ATFGKYTNGAAAPSNSRRVVETYLQTHRMTPDTVPAVQQLSNSLAAAVGSTGSIASTPQG
DVDNLRNTMYLVSEAIRLMDKAGQPAFSADDRAAINNYRAQLDHATKFIPTWVKVAVALA
LGLGTMVGWRRIVVTVGEKIGKQHLTYGQGASAEVVAMVTIGAADMYGLPVSTTHVLSSG
VAGTMAANGSGLQWSTVRSLVLAWLLTLPASIVLAGALYWVFHALL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaatccgcgttacccaccgcagatgccggccgctcacggcgattcggccagctg
gtctttctcgccgtgctcgtcgtcggcggcgcgtatgtgctcactcatctgatggccgat
ctcgcgccggtcggcgagccttcggtgttcccctacgtgctgctcggcatcgcgctgctg
atcgcgctcggcttcgagttcgtcaacggcttccacgacacggccaatgcggtcgccacc
gtgatctacacccattcgctggcgccgaacgtggccgtggtctggtccggactctggaac
ttcgcgggcgtgctgctctcgagcggcgccgtggccttcggcatcctgcagttgctgccg
gtggagctgatcctgcaggtcggcagcggcgccggcttcgcgatggtgttcgcgctgctg
atcgcggcgatcgtctggaacctcacgacctggtacttcggcctgccctcgtctagctcg
cacacgctgatcggctcgatcatcggcgtcggcgtgatgaaccagctcatgcacggcgcc
tcgggcacgagcggcgtggactggagccaggcgctcggggtcggcaaatcgctgctgttc
tcgccgatcgtcggcttcgtgctctccggcctgctgctgcttctgctcaaggggctcgtg
aagctgccgcagctctatcgggaaccgccgaaggacaagacgccgccgttctggattcgc
tgcctgctgatcctgacctgcaccggcgtatcgttcgcgcacggctcgaacgacggccag
aagggcatggggctgatcatgctgatcctgatcggcacggtgcccaccgccttcgcgctg
aacaaggcggtcacgccggccgaatcgcagacctttatcgccgtcgcgcatcaggcggcc
gcgaccttcggcaagtacaccaacggcgccgcggcgcccagcaactcgcgccgcgtggtc
gagacctacctgcagacgcaccggatgacgccggacaccgtgcccgccgtgcagcagttg
tcgaactcgctcgcggccgcggtcggctcgaccggctcgatcgcgagcacgccgcagggc
gacgtcgacaacctgcgcaacaccatgtacctcgtgtcggaggcgatccgcctgatggac
aaggccgggcagccggccttctcggccgacgatcgggccgcgatcaacaactatcgcgcg
cagctcgaccacgccaccaagttcatcccgacctgggtcaaggtcgccgtcgcgctcgcg
ctcggcctcggcacgatggtgggctggaggcggatcgtggtcaccgtgggcgagaagatc
ggcaagcagcatctgacctacggccagggcgcctcggccgaagtcgtcgcgatggtcacg
atcggcgcggccgacatgtacgggctgccggtctcgaccacccatgtgctgtcgtcgggc
gtggcaggcacgatggccgccaacggctcgggcctgcaatggtcgaccgtgcgcagcctg
gtgctggcctggctgctgacgctgccggcctcgatcgtgctggccggcgcgctctactgg
gtgttccacgcgctgctctga

DBGET integrated database retrieval system