KEGG   Burkholderia glumae BGR1: bglu_2g06000Help
Entry
bglu_2g06000      CDS       T00905                                 

Definition
(GenBank) ImcF-like protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    bglu_2g06000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgl02044]
    bglu_2g06000
Secretion system [BR:bgl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bglu_2g06000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: ACR31041
UniProt: C5AMJ0
Position
2:724205..727768
Genome map
AA seq 1187 aa AA seqDB search
MMNARNNMQILGTAEAETTETSRLLAWGPIFLALILAGVAFALVWFKGALFGVLTREAKL
GASVWIFLALVAVLLLHIGLLFGGAYRLVGRVFRAEVGDRDAAVTQTKTLKCDARLQTVC
DELRATRGWWWRYRTRWLLLTGTDALIEDVAPGLKRAGVMPVADAILVHAAPDGIDVGAW
RRQIRQLRRRRPVDSVVHVTDANAPETELPRALATLATDLGWAAPVTLLHAVPATGGHPE
TFEAIGAFPGPSLGGTQPASVLREQLAVIGRHTADAGVRLCVTPTRITYLAQISQYIDEQ
RESIISGWNALFASHWYRSRLAGVIFAPVFETSAAVPTPVPVVPIAPAGAEAAAVVPTGT
QQPVMFQHQPAALLPAWRTIARRRDTGRRVGFYWPNVLAWFVTVAAVTWCAWMTVSFVGN
RQLAREARATANAAAEARPQTAVAWRAQLALQQLIEKLEYRQQHGAPWYLRGGLSRNDEV
LAGLWPPYRIAATRNLQTPVVQTIGDLLKAAGQTRADSLESQDTRSSTYNALKTYLMLGD
PSRAEPAFLKRMLVSQWPRPVEMPLGERDDTGLRLAGFYADHLKAHPGWRIGLNNGLVTS
TRNMLVTQMGLASSDDTVYQGIIEEARGRYADASLETLLAGADARGLFTTSQTVPGIYTR
AAWDGMIAAAINKAASERRTSGDWVLTGAPPAQTIGNMLSRGAIRTAAVIDEKHAAEDLK
QRLTARYFAEYTAAWQGMLNSVRWQPAANLNGSIEQLTRLADAQTSPLIALMKAIQYQAQ
AGRPSQALADTLVRKAQSLIGRDDQAAAPTVNPLDKSFGPLLALMGDTAAVPAAGGKGNP
AANIALNGVSLSRYLTAVTTMRLKLQQIAGSPDAQTMARSLAQAVFQGKLSELSQARDDA
ALTAASLGTAWSGFGDAVFAQPLEAAWQTILQPAAASLNEAWRASVAAPFNAAMSGRYPF
FDTNADASFAELGRYVRPDTGLIARFFATQLAGVLKLEGDHWTPNELAPQALQFDPTFLT
GIRQLSTVGAQLYVQGDARERFEMMALPTPNVTRSELSVDGKQIVYFNQQENWTPLAWPG
TGLNGHAGLTWQTLDAGLRQAFDSTGDWAFLRLLAKADMKQLDSTRYQVTWNTANAEPLS
YVMRTQIGAGPLELLKLRGFRMPERIFIVGKAGVVPVLPPLPPELQP
NT seq 3564 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgctcgcaataacatgcagattctcgggacggccgaggctgagacgaccgaa
accagccggctgctcgcctggggtcccatatttctggcactgatcctggccggggtcgcg
ttcgcgcttgtgtggttcaagggtgcgctgtttggcgtgctcacgcgcgaggcgaagctc
ggcgcatcggtctggattttcctggcgctcgtggcggtgcttctgttgcacatagggctg
ctgttcggtggcgcataccgcctcgttgggagggtgtttcgcgccgaagtcggcgatcgg
gacgccgcagtaacgcagacgaaaacgctcaagtgcgacgctcgcctgcagaccgtctgt
gatgaactgcgcgccacgcgcggctggtggtggcgttatcgaacgcgttggctgcttttg
accggcacggacgctctgatcgaagatgtcgcgcccggcctgaagcgcgcgggtgtaatg
cccgttgccgacgcgatccttgtgcatgccgcaccggatggcatcgatgtcggggcatgg
cgccgccagatccggcagctacgccgccgacgtcccgtcgacagcgtcgtccatgtcact
gacgcaaacgcacccgaaaccgaactaccgcgcgcactggccacgcttgcgacggatctg
ggatgggctgcgcccgtcacgctcctgcacgcggtgccggccacgggcggccaccccgag
acgttcgaggcaatcggcgcgttcccgggtccgtcgctcggcggcacgcaaccggcttcg
gtattgcgcgagcagctcgccgtgatcgggcggcatacggcggacgctggcgtgcggctc
tgcgtcacgcccacgcggatcacctatctggcccagatctcccagtacatcgacgagcag
cgcgaaagcatcatctcgggctggaatgccctattcgcctcgcattggtatcggtcccgg
ttggccggcgtaatattcgcacctgttttcgagacttccgccgcagtgccaacgcccgtt
ccggtggtaccgatcgcgccagccggagcagaagcggcggctgtcgtgccgacggggacg
cagcaaccggtgatgttccagcaccagcctgccgcactgctgcccgcgtggcgcacgatc
gcgcgccggcgcgataccggccggcgggtcggcttctactggcccaatgtgctggcctgg
ttcgtgactgtcgccgcggtcacgtggtgcgcgtggatgaccgtttcgttcgtcggcaac
cggcagctcgcgcgcgaagcgcgcgcaacggcgaatgccgcggccgaggcccggcctcag
accgcagtggcctggcgcgcgcaactggcgttgcagcagctaatcgaaaagcttgagtat
cgccagcaacacggtgcgccgtggtatttacgcggcggactctcgcgcaacgacgaagtg
ctcgccgggctctggccgccataccggatcgcggcgacccgcaacctgcagacgcccgtc
gtgcagacgattggcgacctgctcaaggctgctggtcagacccgggccgacagcctcgag
tcgcaggatacgcgtagcagcacctacaacgcgctcaagacgtacctgatgctcggcgat
ccgtcgcgtgctgaacctgcgttcctcaaacgcatgctggtatcccaatggccgcgcccg
gtcgagatgcccttgggcgagcgcgatgacaccggcctgcggcttgctggtttctatgcc
gatcacctcaaggcgcatcctggatggcgcatcggattgaacaacggtctcgtgacgtcg
acccgcaatatgctggtcacacagatggggctcgcgtcatctgacgacacggtctatcaa
ggcatcatcgaggaggcgagaggcaggtacgcggacgcgtcgcttgaaacgctgctcgct
ggcgcggacgctcgaggtctgttcacgacctcgcagaccgtgccaggtatttatacccgt
gccgcctgggacggaatgatcgccgcagcgatcaacaaggctgcgagcgagcgtcgcacg
agcggcgactgggtgctgaccggcgccccgccggcgcaaaccatcggcaatatgctgtca
cggggtgccatcagaaccgcagccgtgatcgacgaaaagcatgcggccgaggacctgaaa
cagcgcctgacagcgcggtacttcgccgagtacacggcagcctggcagggcatgctcaac
agcgtccgctggcagccggcggcgaacctgaacggctcgatcgagcaactgacacgcctc
gccgacgcacagacatcgccgctcatcgcactgatgaaggcgattcaataccaggcacag
gcaggacggccgtcgcaggccctggccgacacgctggtgcgcaaggcgcagagcctgatt
ggcagggacgatcaggcggccgcgccgactgtcaacccgctcgacaagtcattcggcccg
ctgctcgcgctgatgggcgacaccgctgccgtaccggctgcaggcggcaaaggcaacccg
gcggccaatatcgcgctgaacggcgtgagtctctcgcggtacctgaccgcagtcacgacg
atgcgcctgaagctacagcagatcgcaggcagtcctgacgcgcagacgatggcgcgctcg
ctcgcgcaggcggtgttccagggcaagctctcggagctgtcacaggcacgcgacgacgcg
gcgctgacagccgcgagtctcgggacggcgtggtccggtttcggcgatgcggtattcgcg
caaccgctcgaggccgcctggcagacgatcctgcagccggctgcggcaagcctgaacgag
gcgtggcgggcgagcgtggcggcgccgttcaacgcggcgatgagcggcaggtatccgttc
ttcgacacgaacgccgatgcgtcatttgccgaactcgggcgctatgtgcggcccgacacg
ggcctgatcgcacgcttctttgccacgcagcttgctggcgtgctgaagctcgagggcgat
cactggacgccgaacgagctggcgccgcaggcgctgcagttcgacccgacgttcctgact
ggtatccggcaattgtcgaccgttggcgcgcagctatatgtgcagggcgatgcgcgagag
cgcttcgagatgatggcactaccgacgcccaacgtgacacgctcggagttgtcggttgac
ggcaagcagatcgtctacttcaatcagcaggaaaactggacgccgctcgcgtggcccggt
accggcctgaacgggcacgcggggctgacatggcagacactcgacgccggccttcggcaa
gcgttcgattcgaccggcgactgggcgttcctgcgccttctggccaaggccgacatgaag
caactcgacagtacccgctaccaggtgacgtggaacacggcgaacgccgaaccattgtcc
tacgtgatgcgcacgcagatcggcgcaggaccgctcgaattgctgaagctgcgaggcttc
cggatgcccgagcggatttttatcgtcggaaaggcaggtgtcgtgccggtactgccgcct
ctgccaccggagcttcagccatga

DBGET integrated database retrieval system