KEGG   Burkholderia glumae BGR1: bglu_2g06010
Entry
bglu_2g06010      CDS       T00905                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgl02044]
    bglu_2g06010
Secretion system [BR:bgl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bglu_2g06010
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACR31042
UniProt: C5AMJ1
Position
2:727915..729675
AA seq 586 aa
MRYLREAGREFAEAQPQAARQLGMTTPGAPDDRVAAVYEGFAFLTSRLRMKLDDALPEIT
DPLIDHLWPHAGRTIPSLAILECKPRTGEARILDILPAGLQVRSTPIGSDGTVCVYRTTQ
PVRLLPLEVCEAGVRMREDGRTVIRLAFNLLHREQRLLDDLSRIRLYLHGDRPTASALYA
VLTQQVESIGMRMPRLLDCQLQPQPAMRFEAAGFGPDTRLWPVDRDARDAELDREQTMLE
YFAFPEKFHFVDLCGFNTAGVPPGETRIEFEIVLNGRIAGDVTFGANNIRLFCTPVINLF
ELDAQAIRPNAHDRDYPVRPPASAGDHIEPYDAQSVVAADPRNAMYHEYQSFKEFRHRGG
MMRYESPERYYHSSIRHGVTGQREMWVTLGGHLWDEPGSVPDGHVTVRVLANNGRLPRMA
LSESMITEPVSAFSGVERVRNLTAPTMPLYPPRGGEYDWKVVSHFNAAGSTELNMMDASV
LRGALSLYDWSPQDDNMRRIEAIHYVWLDEDTEIIGTRVDRIVNVNVGIEPSGFAGPGDV
ALFGDVLSRFVGRYACFHYAVRLVLYQGVGGAVRRYPPVLKTGDWL
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgcgctacctgcgcgaagcgggcagagaattcgccgaagcgcagccgcaggccgcgcgg
cagttggggatgacaacacccggcgcgccggacgatcgcgtcgcagcggtctacgagggc
ttcgcattcctgacgagccggctgcgcatgaaactcgatgacgcgctgccggaaatcacc
gacccgttgatcgatcacctgtggccacatgcaggccgcaccatcccgtcgttggcgatt
ctcgagtgcaagcctcgcacgggcgaagcacggattctggacatcctgccagcaggcctg
caggtgcgctcgacgccgatcggctccgacggcacggtatgcgtttatcgcaccacccaa
ccggtgcgtctgctgccgctcgaagtctgtgaggcaggcgtgcggatgcgcgaggacggc
cgcacggtgatccggctcgcgttcaatctgctgcatcgcgaacagcgcctgctggacgac
ctgtcgcgcatccgcctgtatctccacggagatcggcctaccgcgtcggcgctgtacgca
gtcctcacacaacaggtcgagtcgatcggcatgcggatgccgcgcctgctcgactgtcag
ctgcagccgcaaccggccatgcggttcgaggcggccggtttcgggccggatactcggctg
tggccggttgaccgcgacgcgcgtgacgctgaactcgatcgcgagcagaccatgcttgag
tatttcgcgttcccggaaaaattccacttcgttgacctctgcggattcaacacggcgggc
gtgccgcccggcgagactcgcatcgaattcgagatcgtgcttaacggccgcattgccggg
gacgtgacgttcggcgcgaacaacatccgtttgttctgcacgccggtgatcaacctgttc
gagctggacgcacaggcgattcgacccaacgcgcatgatcgggactatccggtacgtccg
cccgcgtcagccggcgatcatatcgagccatatgacgcacagtcggtcgtggcagccgat
ccccgcaacgcgatgtaccacgaataccagtctttcaaggaattccggcaccgtggcggg
atgatgcgctacgagtcgcccgagcgctattaccactcatccatccgccatggtgtcacg
gggcagcgtgagatgtgggtgacgttaggtggccatctatgggatgaacctggtagcgtg
ccagacgggcacgtgacggtccgcgtgctggcaaataatggccgcctgccgcgcatggcg
ctaagcgaatcgatgattaccgagcctgtatcggcgttctccggcgtcgagcgggtgcgc
aatctcacggctcccacgatgccgctgtatccaccgcgcggcggcgaatacgactggaag
gtagtctcacacttcaatgcggctggttcgacggaactgaacatgatggatgcgagcgtc
ttgcgtggtgcgctgtcgttgtacgactggtcgccgcaggacgacaacatgcggcgcatc
gaggcgatccactatgtttggctggacgaagacactgaaatcatcggtacgcgagtcgac
aggatcgtgaacgtgaacgtcggcatcgagccatcgggttttgccggtcccggcgatgtc
gcactcttcggcgacgtgctgagccgcttcgttggccgctatgcctgcttccattacgcg
gtgcggctcgttttatatcagggtgtaggcggggcggttcggcgttatccgcccgtactc
aagacgggagactggttgtga

DBGET integrated database retrieval system