KEGG   Burkholderia glumae BGR1: bglu_2g07460
Entry
bglu_2g07460      CDS       T00905                                 

Definition
(GenBank) Hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgl02044]
    bglu_2g07460
Secretion system [BR:bgl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bglu_2g07460
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACR31165
UniProt: C5AMW4
Position
2:complement(897277..897654)
AA seq 125 aa
MQFLFERLAEPPSFDGTQTFDLRAAVAAQIQRLVSARITRSGGERDLLDFGLPSVVEFEL
NSKPQLELYAQRLARLIARYEPRLKSAKVRIEAHDEALCPYRIAIYGTLDPSNGVDVFHF
ELPSH
NT seq 378 nt   +upstreamnt  +downstreamnt
atgcagttcctgtttgagcgcctggcggaacctccctcgttcgacggcacgcagacgttc
gatctgcgcgccgccgtcgccgcgcagatccagcggctggtcagcgcgcgcatcacgcgc
tcgggcggcgaacgcgatctgctcgacttcggtttgccgagcgtggtggagttcgagctg
aacagcaagccgcagctcgagctgtatgcgcagcggctcgcccgcctcatcgcccgctac
gaaccgcgcctgaagtccgccaaggtgcgcatcgaggcgcacgacgaggcgctttgcccg
tatcgcatcgcgatctacggcacgctcgaccccagcaacggcgtggacgtgttccacttc
gagctgccttcccactga

DBGET integrated database retrieval system