KEGG   Burkholderia glumae BGR1: bglu_2g10930
Entry
bglu_2g10930      CDS       T00905                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgl02044]
    bglu_2g10930
Secretion system [BR:bgl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bglu_2g10930
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACR31490
UniProt: C5AHW0
Position
2:complement(1395408..1397222)
AA seq 604 aa
MENDDPILRYYEAEMRYLRESGREFAKAHPDRARLLNLDRVGDRDPYVERLFEGFAFLTG
RLRQKLDDELPELTEGLVSLLWPHYLRMIPSLSVVQLIPLADKLQKTEIVPAGVPVRSAP
IAIPPPAGADGSVPKTVQCLYRTTQAVTLQPLSITHAGPSVRHDGRSVIRIGFALDGSAR
RNETDLTRLRVHLNADLPTAFAMHLALTRQVDAITWRIPEIRDGEAVPLSGVTIEPAGFS
TEERLWPKAEAAFSGYQLLLEYFTFREKFLFVDLRGVDITKLPASATRFELEIVLKQAYP
SDQRFSAENLRLFCSPVINLFELDAEPIVIDHHETEYRVVPAGHQGGHVETYSVDAIATF
DHDTAERYEYVPFATFRHRGGMLRHEAPERYFHTRVRPGVSGLHETWVILGGHAWETMDT
LPEESLSLRVTGTNGLLPRKGLREASLDELAASPPNVAGVRNLVSPTLPLYPPTEDRFQW
RVLSHLAPNFLSMMNAEVLRGALALYDWTDDELNRRRLAGIRWVSQELIEEVTGGSVERG
VLIEVTLDSHAFSGEGDVMLFGELLHRFFAQYAEINLFTKLSIVSLPSQTRTIWPRSKAQ
RAPL
NT seq 1815 nt   +upstreamnt  +downstreamnt
atggaaaacgacgacccgattctgcgctactacgaggcggaaatgcgctatttgcgcgag
tccggcagggagttcgcgaaagcgcatcccgatcgcgcgcgcctgctcaacctcgatcgc
gtgggcgaccgcgatccgtatgtcgagcggctgttcgagggctttgcattcctgaccggc
cggcttcgacagaaactcgacgatgaactgccggagctcaccgagggactcgtgagcctc
ctatggccgcactatctgcggatgatcccgtcgctgtcggtggtccagctgatcccgctc
gcggacaagctgcaaaaaaccgagatcgtgccggcaggcgtgccggttcgctccgcgccg
attgcgataccgccgccggccggcgccgatggctcggtgccgaagacggttcagtgtcta
taccgaaccacgcaggccgtgacgctgcagccgctttcgatcacgcatgccggcccgagt
gtgcgccatgacggccgttcggtgatccggatcgggttcgcgctcgacgggtcggcgcgc
cgcaacgaaacggacctgacgcgactgcgcgtgcatctgaatgcggatctgccgactgcg
ttcgcaatgcatctcgcgcttacgcgccaggtcgatgcaatcacctggcgcattccggaa
atccgcgacggcgaagcggtgccgctctccggcgtcacgatcgagccggccggtttttcg
accgaagaacggctgtggccgaaggccgaggcggctttctcgggctaccagctgctgctc
gagtattttacgttccgcgagaaattcctgttcgtcgacctacgcggagtcgacatcacg
aagctgcccgcgagcgcgacccgcttcgagctggaaatcgtattgaagcaggcctatccg
tcggaccagcgcttcagcgccgagaacctgcgcctcttctgcagcccggtgatcaatctg
ttcgaactggatgccgaaccgatcgtgatcgatcatcacgaaaccgaatatcgcgtggtg
ccggcaggtcatcagggcgggcatgtcgaaacctactcggtcgacgccattgcgacattc
gaccatgacacggccgagcgatacgaatacgtgccgttcgctaccttccggcaccgcggc
ggcatgttgcggcacgaggcgccggagcgctatttccatacgcgcgtgcgaccgggtgtg
tccgggctgcacgaaacctgggtgattctcggcggtcatgcctgggagaccatggacacg
ctgcccgaggaaagcctgtcgctgcgtgtgacgggcacgaacggactgttgccgcgcaag
gggctgcgtgaagccagcctcgacgagctggcggccagccccccgaacgtcgcgggcgta
cgcaacctcgtgtcgccgaccttgccgctgtatccgccgaccgaagaccgtttccagtgg
cgcgtgttatcgcatctggcgccgaacttcctgtcgatgatgaatgcggaagtgctgcgc
ggtgcactcgcactgtacgactggaccgacgacgagctgaatcgccgccggctggccggc
atccggtgggtctcgcaggagctcatcgaggaggtgacgggcggctcggtcgagcgtggc
gtgctgatcgaggtgacgctcgattcgcatgcgttttcgggcgagggcgacgtgatgctg
ttcggcgagctgctgcaccggttcttcgcgcagtacgcggaaatcaacctgttcaccaag
ctgtcgatcgtgagcctgccgtcgcagacccgcacgatctggccgcgcagcaaagcgcag
cgggctccgctatga

DBGET integrated database retrieval system