KEGG   Burkholderia glumae BGR1: bglu_2g11090
Entry
bglu_2g11090      CDS       T00905                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    bglu_2g11090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgl02044]
    bglu_2g11090
Secretion system [BR:bgl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bglu_2g11090
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACR31503
UniProt: C5AHX3
Position
2:1418865..1419350
AA seq 161 aa
MAIPAYMWLKDDGGADIKGSVTVQGREGSVELVAFNHGVHIPTDGNTGKLTGTRVHKPIT
LTKETDASTPYLYKAVTSGQTLKSVEIKWYKIDDAGKEKEYFNTKLDNVKIVAVNPVMYD
IKNPDYEKHNHLENVELRYETITWSYKDGNIIHKDTWNERS
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcaattccggcctatatgtggctcaaggacgatggcggtgccgacatcaagggttcg
gtgacggttcagggccgagaaggcagcgtcgagctcgtcgcgttcaatcacggcgtgcac
atcccgaccgacggcaacacgggcaagctcaccggtacgcgtgtacacaagccgattacg
ctcacgaaggaaacggacgcgtcgacgccatacctgtacaaggccgtgacgagcggccag
acgttgaagtcggtcgaaatcaagtggtacaagatcgacgacgcgggcaaggagaaggag
tacttcaacacgaagctcgacaacgtcaagatcgtggccgtcaacccggtgatgtacgac
atcaagaacccggactacgagaaacacaaccacctcgaaaacgtcgaactgcgctacgag
acgatcacctggtcgtacaaggacggcaacatcatccacaaggacacctggaacgagcgt
tcctga

DBGET integrated database retrieval system