KEGG   Burkholderia glumae BGR1: bglu_2p0550Help
Entry
bglu_2p0550       CDS       T00905                                 

Definition
(GenBank) D-amino acid oxidase Aao_1
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00260  Glycine, serine and threonine metabolism
bgl00311  Penicillin and cephalosporin biosynthesis
bgl00330  Arginine and proline metabolism
bgl00472  D-Arginine and D-ornithine metabolism
bgl01100  Metabolic pathways
bgl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bglu_2p0550
   00330 Arginine and proline metabolism
    bglu_2p0550
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    bglu_2p0550
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    bglu_2p0550
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     bglu_2p0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 FAD_binding_3 NAD_binding_8 Pyr_redox_2 NAD_binding_7 Pyr_redox AlaDh_PNT_C Shikimate_DH GIDA
Motif
Other DBs
NCBI-ProteinID: ACR32717
UniProt: C5ANC4
Position
bglu_2p:58154..59320
Genome map
AA seq 388 aa AA seqDB search
MREVGEKGRALVIGAGVAGQTTALCLHERGIHVTVVGEKFAPNITSVVAGALWEWPPAVC
GYHHDEISLERSKQWCMASFRKFEALAADPATGVYIRPVNFYFRNRIEEHALHLKKMNEI
RQHVPGFRRDPALIRENGVNPGIGLVDAYCHLAPMVDTDVYMAWLMDQMIANDIPVIQQR
IEGELQMNEARLKADFGVDAIVNCAGLGAAELSGEPMYPLRGAVIRLVNDGSRMPRLDQA
HCVSHDHVTGVDEIVFIVPRGEDRIVLGAIAEADEWGTDIGFDNHEPIRRMYRRGIEFMP
ALANAEIDPGEPVRVGLRPFSHGNVRLEAVSGTHILHNYAHGGAGVTLSWGCALEAAERV
ENMLSAAPDGIEQDGRPGAHANDVRVGA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagggaagttggggagaaggggcgtgcgctagtcataggcgccggcgtggccggccag
acgacggcgctgtgcctgcacgagcgcggcatccatgtgacggtagtcggcgagaaattc
gcaccgaacattacgtcggtggtggccggggccttgtgggaatggccacccgccgtttgc
ggttatcaccacgacgagatctcgctggagcgctcgaagcagtggtgcatggcctcgttc
cgcaagttcgaggcactcgcggccgatccggcgacgggcgtctatatccgtccggtcaat
ttctactttcgcaaccgcatcgaggaacacgcactccatctcaagaagatgaacgagatc
cgccagcacgtgccgggtttccggcgcgacccggccctgatccgcgagaacggcgtgaat
ccgggcatcggactcgtcgacgcatattgtcatctcgcgccaatggtcgatacagacgtc
tacatggcctggctgatggatcagatgatcgcaaacgacatcccggtcatccagcagcgg
atcgaaggtgagctgcagatgaacgaggcgcgcctgaaggcggatttcggcgtcgatgcg
atcgtcaactgtgcgggactcggcgcggccgagttgagcggcgagccgatgtatccgttg
cgcggtgccgtgatccgtctcgtgaacgacggcagcagaatgccgcgcctcgatcaggcg
cactgcgtgtcacacgatcatgtaacgggtgtcgacgagatcgtattcatcgtgccgcgt
ggcgaggaccgaatcgtgcttggtgcgatcgcggaagccgacgaatggggaacggacatc
ggattcgacaatcacgaaccgatccggcgaatgtatcggcggggcatcgaattcatgccc
gcgctcgcgaacgccgagatcgatcctggcgagccggtgcgggtcgggctgcggccgttc
agccatggcaacgtgcgtctcgaagcggtatcgggcacccacatcctgcacaactacgcg
cacggtggggccggtgtgacgttgtcgtggggttgcgcgctcgaggctgcggagcgggtc
gagaacatgctgtcagccgccccggacggcatcgagcaggatggccgtccaggcgcccac
gccaacgacgtgcgggtcggggcttga

DBGET integrated database retrieval system