KEGG   Burkholderia glumae BGR1: bglu_3p0180
Entry
bglu_3p0180       CDS       T00905                                 

Definition
(GenBank) TraG-like protein
  KO
K12056  conjugal transfer mating pair stabilization protein TraG
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgl02044]
    bglu_3p0180
Secretion system [BR:bgl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   bglu_3p0180
SSDB
Motif
Pfam: TraG_N DUF4726
Other DBs
NCBI-ProteinID: ACR32794
UniProt: C5ANK1
Position
bglu_3p:complement(18630..22076)
AA seq 1148 aa
MNMEIDTYGNVDTLYYVFNGIASFMGSGSFSGFMRFTLLSGLLIAMVAAIGRKSTDIVKW
FASAMFITQLLVAPVENVFITDVTGVQPTREVDHVPAYLSAIAQASTTVSTAVTQAYETV
FSVPDSLQLQKGDLGFGISVLQKVNQAQIVDPGLEADLMQFFKECTVYDIQDGAINPQTI
MSGTDPFNTVFTQTSPARYVTTNTLTANPTTDTCLATGTLLLIRVTDAEQKAEQMYGKEM
YPQVTDASAAKAAFVNAIGDSYGFILQSSQNASSALRQAMFNNVWRQAGADLPAMLNDPA
RVAEVNALMSSAQAAVAANGSMASVAILAKETLPTVRNYAEAIIYTIFPIVIVLCLVGGG
EAAKRILGGYAKTIAWIGLWPVIFAVLNGLSLMHLSSKMQAMSLQAGVPFGMAAKFGSTL
IDEQVLLGYMVILTPALAWGLLNMATTSVVGAFQGVAGGFQGIAQQIGGQQAQGDENIGN
VHMDTSSIGNSTRNVTSANKYDTAGLFRTGSTTIEQGTGSSFTNFDNGLITRADTQSSLG
FAMSSQSAIEKTVGADTSTGISATKTSTAFAARDQVASGTTSLASSKERGNSQRSGDEAT
KGVHGSTTQAVDLRRTKDQQYVIDQTHSVEDQLSTGVRGSLQLGGTFEKSFGDGAPGQPA
SGVRGGMPAGARQGAPRSVGAGTGNPPANSPIFSQAEEDRLAQKASSLGKSPQEIQDVRD
AYRNKVRGVDYATGGGTGGGRAAGKLGGELAIDGGRTRAWRDSEAQRFVDQYGSFAGYTE
GSQVSHDASKNHSEYKGAESGQHARTEHAASLTEQASSGARDAADLTRTADVRQRGSTQQ
VSRVDTTNNLLTPENLQAVAARNGMRYGRLMTLPAAEIQRLVSEDALMRDLVKRNSALPP
TARDGSSLPSGQGDVVRQNKHDRSGIGANIPGAFQRFSSDVGPVDTTPLDVKPSVPSEVS
GAQARVDAVRQRVSDDADLPIRQVQDHVIPSDDNRSLMTLDRSPARPLVTRPTGESPGTS
SPERLSEADFKIVPIDGPSSEMTPARSAGAAVVQPKLSAGDFQIISADDHGGGSVTAATG
VATDDLNLSRPDFTRMPADGLTANASAAKPTSISASSDSLPARSESGSSIGRTDPAGSSL
GDKEGGKQ
NT seq 3447 nt   +upstreamnt  +downstreamnt
atgaacatggaaatcgacacctacgggaacgtcgacacgctctattacgtgttcaacggc
atcgcgtcgttcatgggtagcggctcgttcagcggcttcatgcggttcacgctgctgagc
ggactgttgatcgcgatggtcgccgccatcgggcgcaagagcacggacatcgtgaagtgg
ttcgcgagcgcgatgttcataacgcagctgctcgtcgcgccggtcgagaacgtgttcatt
acggatgtgaccggcgtccagccgacccgcgaggtggaccacgtccccgcctacctgagc
gcgatcgctcaggcgagcacgacggtgtcgacggcggtcacccaggcctatgagacggtg
ttcagcgtacccgattcgcttcagctgcagaagggcgacctcggattcgggatatccgtg
cttcagaaggtgaatcaggcgcagatcgtcgatcccggcctcgaggcggacctgatgcag
ttcttcaaggaatgcacggtctacgacatccaggacggggcgatcaacccgcaaacgatt
atgagcgggaccgatccgttcaataccgtcttcacgcaaacgagcccggcccggtacgtg
acgaccaacacgctgaccgcgaatccaacgacggacacctgtctggccaccggaacgctg
ctgttgatccgcgtcacggacgccgagcagaaggcggaacagatgtacggcaaggagatg
tacccccaggtgaccgacgcgtcggccgccaaggcggcgttcgtcaatgcgatcggcgac
tcgtacggcttcatcctgcagtcgtcgcagaacgcctcgtcagcgctgcgccaggccatg
ttcaacaacgtctggcgccaggctggtgccgatctgccggcgatgctcaatgacccagcc
cgcgttgccgaggtgaatgcgctgatgagttcggcgcaggctgccgtggccgcgaacggc
tcgatggcaagcgtggccatcctggcgaaggagacgctgccgaccgtccgcaattatgca
gaggcgattatctacacgatcttcccgatcgtgatcgtgctgtgtctcgtcggagggggg
gaggcggccaagcgcatcctgggcggttacgccaagaccatcgcgtggatcgggctgtgg
ccggtgatcttcgcggtactcaacggcctctcgctcatgcatctgagcagcaagatgcag
gcgatgtcgctgcaggcaggtgtgccgttcggcatggcggccaagtttggcagcacgctc
atcgatgaacaggtgctgttggggtacatggtgatcctgacgccggccctcgcgtggggg
ctgctcaacatggccaccaccagcgtggttggcgcgttccagggagtcgctggaggcttc
caaggcatcgcgcaacagattggtggccagcaagcgcagggcgacgagaacatcggcaac
gtccacatggatacgtcgtcgatcggtaactcgacgcgcaatgtcacgtcggcgaacaaa
tacgacaccgcgggcctgttcagaacggggtcaacgaccattgagcagggaacgggctcg
tcgttcacgaacttcgacaacgggctcatcacgcgcgctgacacccagagcagcttggga
tttgcgatgtcgtcgcagagcgcgattgaaaagaccgtgggcgccgatacctcgactggc
atctcggccaccaaaaccagcactgcattcgccgcccgggatcaggtggcgtccggtacg
acttccctcgcaagcagcaaggagcgcggtaactcgcagcgctcgggcgatgaggcgacc
aaaggagtgcatggttcgacgacgcaagccgtggacctccggcggacgaaggaccagcag
tatgtgattgatcaaacacactctgtcgaagaccaactatcaaccggtgtgcgcgggtca
cttcagctggggggaactttcgaaaagtccttcggcgacggcgcgcccggccagcccgct
agcggcgtgcgaggcggaatgccggccggcgctcgccaaggcgcaccgcgcagtgtcggg
gctggcaccggtaacccgcctgctaactcgccgatcttcagtcaagcagaggaagatcgg
ctggcgcagaaagcttcaagtctcggtaagtctccgcaagaaattcaagatgttcgggat
gcctatagaaataaagttcggggcgttgattatgcaactggtggagggactgggggcggc
cgcgccgctgggaaacttggaggagaactcgcgattgatgggggacgaacaagggcgtgg
cgagatagcgaagcacagaggtttgttgaccagtacggaagttttgcgggctacacggag
ggcagccaggtttcccacgacgcctcgaagaaccactccgaatacaagggggctgagtca
ggtcagcatgctcgcacggagcatgcagcttccctcaccgagcaagcctcgtccggcgcg
cgcgatgcagcggacctgactcgcacggcagacgttcggcagcggggatcgacgcaacaa
gtatcgcgtgttgacacgaccaacaatctgctgacccctgagaacctgcaagcggttgcc
gctcgcaacggtatgcgatatggccggctgatgacgttgcccgccgcggagattcagcgc
cttgtcagtgaggatgcgctgatgcgggacctcgttaagcgcaattccgcgttgccgccg
acagcgcgtgacggctcgtcgttgccgtctgggcagggcgatgtcgtccgccaaaacaag
cacgatcggtcgggtatcggcgccaatattccaggggctttccagcgcttttcgagcgac
gtggggccggtagacacgacgcctctggatgtgaagccttccgtccccagtgaggtgagc
ggcgcccaagctcgagtcgatgccgtgaggcaacgcgtatcggacgatgcggatttgccc
atcaggcaggtacaggaccacgttattccgtcggacgacaacaggtccctgatgacgcta
gataggtcgccggcgcgcccgctcgtaaccaggcccacgggtgaatcgccggggacgagt
tcgccagaacgcctgtccgaggctgatttcaagatcgtcccgatcgacggcccgtctagc
gaaatgacacccgcccgttcagcaggagcggccgtggtccagccgaagctctctgcgggg
gatttccagatcatctcggcggacgaccatggaggcgggtctgtgacggcagccaccggc
gtagcaacagatgatctgaatctgtcccggccggatttcacgcgcatgcccgctgatggc
ctgacagccaacgcaagcgccgctaagcccacttctatctcggcgtctagcgactcactg
ccggctcggtcggagtcgggtagctcgatcgggcgaactgaccccgctggatcgtcgctt
ggagacaaggagggtggaaagcaatga

DBGET integrated database retrieval system