KEGG   Burkholderia glumae BGR1: bglu_3p0350
Entry
bglu_3p0350       CDS       T00905                                 
Name
(GenBank) TraK
  KO
K12066  conjugal transfer pilus assembly protein TraK
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgl02044]
    bglu_3p0350
Secretion system [BR:bgl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   bglu_3p0350
SSDB
Motif
Pfam: TraK
Other DBs
NCBI-ProteinID: ACR32811
UniProt: C5ANL8
Position
bglu_3p:complement(39931..40671)
AA seq 246 aa
MKPLYLRRRGVARLMLPLVAPLAALFVAGPASAISIVKGADRQAQQVFVSAAEYNLLTMS
GGRQITKVVPTVPGSLAWTQAGNQFWFKPSNPTALNETITIFVFDDAGVSYRLSLVPGPR
PAEDVRIQPPASSTGRALRASAFQRHVKLLILAMSGAQSVPQVAYTSVETAVPLWKEATL
TRVREYSDGDLVGETYTLANTSHNDLSLDERELYAPGVLAVAIEDANLPAGASTIVYVVR
ERGDHD
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaaaccactctaccttcgtcgccgcggtgtcgcgcggctcatgctcccactcgtcgca
ccgctcgccgcgctgttcgtcgccgggcctgccagcgcgatctcgatcgtcaagggcgcg
gaccggcaagctcagcaggtcttcgtctcagccgccgagtacaacctgctcacgatgtcg
ggcggccggcagatcaccaaggtggtaccgaccgttcccggatcgctggcgtggacgcag
gcgggcaaccagttctggttcaagccgtccaaccccaccgcgctcaacgaaaccatcacg
atatttgtgttcgatgacgcgggcgtcagctaccgcctttcgctggtgcccggtccacgg
ccggccgaggacgtccgtatccagccgcccgcctcgagcacaggccgcgcgctgcgcgcc
tccgcgttccagcgtcacgtcaagctcttgattctggcgatgtccggtgcccagtccgtg
ccgcaggtcgcgtatacgtccgtcgagacggccgtgccgctctggaaagaggcgacgctc
acccgcgttcgcgagtacagcgatggtgacctggtgggcgagacgtacacgctcgcgaac
acctcgcataacgacctgtcgctcgacgagcgcgagctgtatgcgcccggggtgctggcc
gtagctatcgaggatgccaatcttcccgccggcgccagcacgatcgtctatgtggttcgc
gagcgaggcgaccatgactga

DBGET integrated database retrieval system