KEGG   Burkholderia glumae BGR1: bglu_4p0220
Entry
bglu_4p0220       CDS       T00905                                 
Name
(GenBank) conjugative transfer pilus assembly protein TraH
  KO
K12072  conjugative transfer pilus assembly protein TraH
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgl02044]
    bglu_4p0220
Secretion system [BR:bgl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   bglu_4p0220
SSDB
Motif
Pfam: TraH zf-TFIIB
Other DBs
NCBI-ProteinID: ACR32903
UniProt: C5ANW0
Position
bglu_4p:complement(25383..26828)
AA seq 481 aa
MKPSRWVAALVAGVIAASPIASDAMSMQQVFDSINSMGNVSSPRVLQGETMNMYSGGSVF
MRTPHKTYQLASVTAPSWGAGCGGIDLFTGGFSFINKEQFVALLRNIGSNALGYAFKLAL
QNLCPTCDNVMQSLQAIAKDINRMNIDSCQAAEGVVNAVTPDTWKKEQANLADTAGPFMN
LYSDMTDAWSNTSNNATQAAATINTATAQNPNLAAKQPYGNVTWQALLQLPDLSTSDREF
LMSLVGTVIFPDPSDSNGTEVNPIFLPRIGSVTVEELVGNDPASATTDTIQLYQCDETTK
CLNPSTQEVQFTTFRSLVQAKLQRIVDAVATRSPLADPTDTFQFLSMTDLPVYKMIAVGT
RLNNSSVADQMLATYQSLMAAKYAEAYIRGSAEDLRRAIARYSTVSTSTSLLNQTTRINE
SIDSVEREARDVVMEAFRQTSNAWALVEELQSMERAIHSSISPSLRNSLAFGQTLTSGST
Q
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaaaccgtcccgttgggtcgccgcgctcgtcgccggcgtgatcgccgccagtcccatc
gcatccgatgcgatgtcgatgcagcaggtatttgattccatcaactcgatgggcaacgta
tctagcccgcgcgtgctgcagggcgagacgatgaacatgtacagcggcggcagcgtcttc
atgcgcacaccgcacaagacctatcagctcgcgagcgtgaccgcgccctcctggggcgcg
ggatgtggcgggatcgacctgttcactggcggcttcagtttcatcaacaaggagcagttc
gttgccctcctgcgcaacatcggctcgaatgcgctcggctacgccttcaagctcgcgctg
cagaacctctgccccacctgcgacaacgtcatgcagtcgctgcaggcgatcgccaaggac
atcaaccggatgaacatcgactcgtgccaggcagccgagggcgtcgtgaacgccgtgacg
ccggacacgtggaagaaggagcaggcgaacctcgcggacaccgccggaccgttcatgaac
ctctattcggacatgacggacgcgtggtcgaacaccagcaacaacgccacccaggccgcg
gcaacaatcaacacggcgaccgcgcagaacccgaatctcgcggccaagcagccgtatggg
aacgtcacgtggcaggcgctgctgcagctgcccgacctcagcacgtcggatcgcgaattc
ctgatgtcgctcgtcggcacggtgatcttcccggacccctccgattcgaacggcaccgaa
gtcaacccgattttcctgccccgcatcggtagcgtgaccgtcgaggaactcgtcggcaac
gatccggccagcgcgaccacggacaccatccagctctaccagtgcgacgagacgacgaag
tgcctgaatccgtccacccaggaggtgcagttcaccacgttccgatcgctcgtccaggcg
aagctgcagcgcatcgtcgacgcggtggcgacccggtcgccgctggctgatcccaccgac
acattccagttcctgagcatgaccgacctgcctgtctacaagatgatcgcggtcgggacg
cgactgaacaatagctctgttgccgaccagatgctggccacctaccagtctctgatggcc
gccaagtacgcggaagcctatatccgcggctcggccgaggatctgcgccgcgcgatcgcg
cgctacagcaccgtcagcacgagcacatcgctgttgaaccagacgacgcgtatcaacgag
agcatcgactcggtggagcgcgaagcgcgcgacgtggtcatggaggccttccgccagacg
tcgaacgcatgggcgctcgttgaggagcttcagtccatggagcgtgcgattcacagcagc
atctcgccgtcgctgcgcaattcgctcgcgttcggccagaccctgacatcggggtcgacg
caatga

DBGET integrated database retrieval system