KEGG   Bordetella genomosp. 13: CAL15_01460Help
Entry
CAL15_01460       CDS       T05441                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bgm  Bordetella genomosp. 13
Pathway
bgm00430  Taurine and hypotaurine metabolism
bgm00620  Pyruvate metabolism
bgm00640  Propanoate metabolism
bgm00680  Methane metabolism
bgm01100  Metabolic pathways
bgm01120  Microbial metabolism in diverse environments
bgm01200  Carbon metabolism
Module
bgm_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CAL15_01460
   00640 Propanoate metabolism
    CAL15_01460
  09102 Energy metabolism
   00680 Methane metabolism
    CAL15_01460
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CAL15_01460
Enzymes [BR:bgm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CAL15_01460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ARP93168
UniProt: A0A1W6Z707
Position
complement(317325..318551)
Genome map
AA seq 408 aa AA seqDB search
MADVILVLNAGSSSIKFCVFDAGSEALPMLLRGQIEGLYTAPSFRLKDVAGADIEAKQWE
KGAELGHAGGVAYLVDYLRSQREGHRLVAVGHRVVHGGIAYASPVLVTPEVMRALAKLTP
LAPLHQPHNLKPIEVVAQLRPDLPQVACFDTAFHRRQPEVAQAFALPRSITGQGVRRYGF
HGLSYEYIASTLAELDPKAASGRTIVAHLGNGSSMCALVERRSVASTMGFTAVDGLPMGT
RSGNLDPGVLLYMMDELGMDARAIENLIYKQSGLLGVSGISSDMRTLLDSGEADARFAVD
LYTYRIGRELGSLVAAAQGIDALVFTAGIGEHAPTIRERVCRDAAWLGIELDAAANRKNR
LRIHAPGSRVSAWVIPTNEELMVARHTWKTCSQASPNTAVPDAPGTTS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgtgattcttgtgctcaatgccggttcatccagcatcaagttctgcgtgttc
gacgcaggcagcgaggcgcttccgatgctgttgcgcggccagatcgagggtctctatacc
gccccaagcttcaggctgaaggacgtcgccggcgccgacatcgaggcgaagcaatgggag
aagggcgccgaactggggcacgcgggcggagtggcctatcttgtcgattatctgcgcagc
caacgcgagggccacaggctggtggctgtcgggcatcgcgtggtgcacgggggtatcgcg
tatgccagccccgttctcgtcacgcccgaggtgatgcgcgcgctggcgaagctgacgccg
ctcgcgccgctgcaccagccgcacaacctgaagcccatcgaagtggtcgcgcagttgcgg
cccgacctgccgcaggtggcctgcttcgacacggctttccatcgacgccagcccgaagtg
gcacaggccttcgcgctgccccgctcgatcacgggccagggagtgaggcgctacggattc
catggactgtcgtacgagtacatcgccagcacgctggcggaactcgacccgaaggccgcc
tcgggccgcaccatcgtcgcccacctgggcaacggcagcagcatgtgcgcgctggtcgag
cgccgcagcgtggccagcaccatgggtttcaccgccgtcgacggcctgccgatgggcacg
cgcagcggcaacctggaccccggcgtcctgctgtacatgatggacgaactgggcatggac
gcgcgcgccatcgagaacctcatctacaagcagtccgggctgctcggcgtgtcgggcata
tcgagcgacatgcgcaccctgctcgacagcggagaggcggatgcgcgcttcgcggtggac
ctgtacacgtatcgcatcgggcgtgaactgggatcgctggtggccgcggcacagggcatc
gatgcgctggtctttacggccggcatcggcgagcatgcgcccacgatacgcgaacgggtg
tgccgcgacgcggcatggctcggcatcgagctcgatgcggccgccaaccggaagaacagg
ctgcgcatccacgcgccgggcagcagggtgtcggcgtgggtgattcccaccaacgaagaa
ctgatggtggcgcgccacacctggaaaacgtgcagccaggcgtcgccgaacactgccgtg
ccggacgcaccaggaacgacatcatga

DBGET integrated database retrieval system