KEGG   Bordetella genomosp. 13: CAL15_05650Help
Entry
CAL15_05650       CDS       T05441                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bgm  Bordetella genomosp. 13
Pathway
bgm00430  Taurine and hypotaurine metabolism
bgm00460  Cyanoamino acid metabolism
bgm00480  Glutathione metabolism
bgm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CAL15_05650
   00460 Cyanoamino acid metabolism
    CAL15_05650
   00480 Glutathione metabolism
    CAL15_05650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bgm01002]
    CAL15_05650
Enzymes [BR:bgm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     CAL15_05650
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     CAL15_05650
Peptidases and inhibitors [BR:bgm01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   CAL15_05650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ARP93916
UniProt: A0A1W6Z926
Position
1236101..1237690
Genome map
AA seq 529 aa AA seqDB search
MSSCDWSFPYPSQKMPVMARNVVSTSQPLAAQAGLRMLLQGGNAVDAALATAIALTVVEP
VMNGIGGDMFVQVWKDGRLQGLNSTGCAPAGWTDDRFAGRDAMPSIGWDTVTVPGQVAGW
KALSDRHGKLPFATLFEPAIAYAEEGYAVSPTVARQWANQAPKLAEQPGFKETFLRLGRA
PRAGEHWRFPEQARTLRLIAETGGESFYRGELAERIDAHARNTGGALRATDLAAHQPMWV
EPVSQDFRGYTLHEIPPSGQGIAALIALGILDRFDLEAMGRDSADFYHVSLEAMKLAFAD
LHHHISDPATMKVSTAQLLDPAYLAERAKLISMERAGAPGAGAPSVGGTVYLAAADADGT
MVSFIQSNYHGFGSGVVVPDTGISLHNRGCGFVLTPGHVNRVAPGKRPLHTIIPGFVTRA
GQPVMAFGVMGGSMQAQGHLQVMARLGAYNQNVQAISDAPRFRVENGPVVTVESHLPADV
AQALRDRGHNLEVAQPLSLDFGAAQLIQRGEYGYVAASDSRRDGQAVGY
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctgcgattggtccttcccttatccctcccagaaaatgcccgtgatggcgcgc
aacgtggtcagcaccagccagccgctggcggcgcaggcggggctgcgcatgctgctgcag
ggcggcaacgcggtcgacgcggccctggccaccgccattgccctgaccgtggtcgagcct
gtgatgaacggcatcggcggcgacatgttcgtgcaggtctggaaagacggcaggctgcag
ggcctgaactcgaccggctgcgcgcccgccggctggaccgatgaccgcttcgcgggccgc
gacgcgatgccgtcgatcgggtgggacaccgtcacggtgccgggccaggtggcgggctgg
aaggcgctgtccgaccgccatggcaagctgcctttcgccaccctgttcgaaccggccatc
gcctatgccgaggaaggctacgcggtgtcgcccacggtggcccgccagtgggccaaccag
gcgcccaagctggccgagcagcccggcttcaaggaaaccttcctgcgcctgggccgcgcc
ccgcgcgccggcgagcactggcgctttcccgagcaggcccgcacgctgcgcttgatcgcc
gaaaccggcggcgagagcttctatcgcggcgaactggccgagcgtatcgatgcgcatgcc
cgcaacaccggcggcgcgctgcgcgcgaccgacctcgccgcgcaccagccgatgtgggtg
gagccggtgtcgcaagatttccgcggctacacgctgcacgagatcccgcccagcgggcag
ggcatcgccgcgctgatcgcgctgggcatcctggatcgcttcgacctggaggccatgggc
cgcgacagcgccgacttctatcacgtcagcctcgaggccatgaagctggccttcgccgac
ctgcaccatcacatttccgatccggccaccatgaaggtgagcacggcgcagctgctcgat
ccggcgtacctggccgagcgcgccaagctgatctcgatggaacgcgcgggcgcccccggc
gcgggcgcgccctcagtgggcggcacggtgtacctggccgccgcggacgccgacggcacc
atggtgtcgttcatccagtccaactaccacggcttcggttcgggcgtggtggtgccggac
acgggcatctcgctgcacaaccgcggctgcggcttcgtgctgaccccgggccatgtgaat
cgcgtggcgcccggcaagcggccgctgcacaccatcatccccggtttcgtcacccgcgcc
ggccagccggtgatggccttcggcgtgatgggcggatcgatgcaggcacagggccatctg
caggtgatggcgcgcctgggcgcctacaaccagaacgtgcaggccatcagcgatgcgccg
cgcttccgcgtcgagaacggcccggtggtgacggtggaatcgcacctgccggccgacgtg
gcgcaggcgctgcgcgatcgcggccacaatctcgaagtggcgcagccgctgagcctggat
ttcggggcggcgcagttgatccagcgcggcgagtacggctacgtggccgcctcggattcg
cgccgcgacgggcaggccgtggggtattga

DBGET integrated database retrieval system